Phodopus roborovskii (desert hamster): 127215720 Help Entry 127215720         CDS       T08852                                  Symbol Ifng Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism prob  Phodopus roborovskii (desert hamster) Pathway prob03050   Proteasome prob04060   Cytokine-cytokine receptor interaction prob04066   HIF-1 signaling pathway prob04217   Necroptosis prob04350   TGF-beta signaling pathway prob04380   Osteoclast differentiation prob04612   Antigen processing and presentation prob04630   JAK-STAT signaling pathway prob04650   Natural killer cell mediated cytotoxicity prob04657   IL-17 signaling pathway prob04658   Th1 and Th2 cell differentiation prob04659   Th17 cell differentiation prob04660   T cell receptor signaling pathway prob04940   Type I diabetes mellitus prob05140   Leishmaniasis prob05142   Chagas disease prob05143   African trypanosomiasis prob05144   Malaria prob05145   Toxoplasmosis prob05146   Amoebiasis prob05152   Tuberculosis prob05160   Hepatitis C prob05164   Influenza A prob05168   Herpes simplex virus 1 infection prob05200   Pathways in cancer prob05235   PD-L1 expression and PD-1 checkpoint pathway in cancer prob05321   Inflammatory bowel disease prob05322   Systemic lupus erythematosus prob05323   Rheumatoid arthritis prob05330   Allograft rejection prob05332   Graft-versus-host disease prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     127215720 (Ifng)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     127215720 (Ifng)    04630 JAK-STAT signaling pathway     127215720 (Ifng)    04066 HIF-1 signaling pathway     127215720 (Ifng)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127215720 (Ifng)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     127215720 (Ifng)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     127215720 (Ifng)    04612 Antigen processing and presentation     127215720 (Ifng)    04660 T cell receptor signaling pathway     127215720 (Ifng)    04658 Th1 and Th2 cell differentiation     127215720 (Ifng)    04659 Th17 cell differentiation     127215720 (Ifng)    04657 IL-17 signaling pathway     127215720 (Ifng)   09158 Development and regeneration    04380 Osteoclast differentiation     127215720 (Ifng)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127215720 (Ifng)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     127215720 (Ifng)   09172 Infectious disease: viral    05160 Hepatitis C     127215720 (Ifng)    05164 Influenza A     127215720 (Ifng)    05168 Herpes simplex virus 1 infection     127215720 (Ifng)   09171 Infectious disease: bacterial    05152 Tuberculosis     127215720 (Ifng)   09174 Infectious disease: parasitic    05146 Amoebiasis     127215720 (Ifng)    05144 Malaria     127215720 (Ifng)    05145 Toxoplasmosis     127215720 (Ifng)    05140 Leishmaniasis     127215720 (Ifng)    05142 Chagas disease     127215720 (Ifng)    05143 African trypanosomiasis     127215720 (Ifng)   09163 Immune disease    05322 Systemic lupus erythematosus     127215720 (Ifng)    05323 Rheumatoid arthritis     127215720 (Ifng)    05321 Inflammatory bowel disease     127215720 (Ifng)    05330 Allograft rejection     127215720 (Ifng)    05332 Graft-versus-host disease     127215720 (Ifng)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     127215720 (Ifng)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     127215720 (Ifng)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:prob03051]     127215720 (Ifng)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127215720 (Ifng)    00536 Glycosaminoglycan binding proteins [BR:prob00536]     127215720 (Ifng) Proteasome [BR:prob03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     127215720 (Ifng) Cytokines and neuropeptides [BR:prob04052]  Cytokines   Interferons    127215720 (Ifng) Glycosaminoglycan binding proteins [BR:prob00536]  Heparan sulfate / Heparin   Cytokines    127215720 (Ifng) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma DUF6613 Motif Other DBs NCBI-GeneID:  127215720 NCBI-ProteinID:  XP_051032149 UniProt:  A0AAU9YTK5 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MNATRCVLALLLCLTQAMSGCYGQGTLIEEIENLKEYFNSSSLDVGNGGDLLFNILMNWQ KDGDTKIIESQIVSFYFKLFEALKGNQAIQRSIDTIKADLFVKFFNSSMEKLNDFVKLTK IPVNDPQVQRKAINELLSVMPHLSPKLSLRKRKRSRCCFGGGNRPVKNNPASSAI NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgaacgcgacacgttgcgtcttggctttgttgctctgcctcacccaggctatgtctggc tgctacggccagggcacactcattgaagaaatagaaaacctgaaggaatattttaactca agtagcttagatgtcgggaatggaggggacctcctctttaatatcttgatgaactggcag aaggacggtgacacaaaaattattgagagccagattgtctccttttacttcaaactcttt gaagccctgaagggcaaccaggccatccagaggagcatagacaccatcaaggcagacctg tttgttaaattcttcaacagcagtatggagaaactcaatgacttcgtgaagctcacgaag attccggtaaatgacccccaggtccagcgcaaagccatcaatgaactcctgagtgtgatg ccccacctgtcaccaaaacttagcctaaggaaacggaaaaggagccggtgctgtttcggg ggtggaaatcgtcccgttaagaataaccctgccagcagcgctatttga

DBGET integrated database retrieval system