Phodopus roborovskii (desert hamster): 127219302 Help Entry 127219302         CDS       T08852                                  Symbol Il4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04060   Cytokine-cytokine receptor interaction prob04151   PI3K-Akt signaling pathway prob04630   JAK-STAT signaling pathway prob04640   Hematopoietic cell lineage prob04657   IL-17 signaling pathway prob04658   Th1 and Th2 cell differentiation prob04659   Th17 cell differentiation prob04660   T cell receptor signaling pathway prob04664   Fc epsilon RI signaling pathway prob04672   Intestinal immune network for IgA production prob05140   Leishmaniasis prob05200   Pathways in cancer prob05310   Asthma prob05320   Autoimmune thyroid disease prob05321   Inflammatory bowel disease prob05330   Allograft rejection Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     127219302 (Il4)    04151 PI3K-Akt signaling pathway     127219302 (Il4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127219302 (Il4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     127219302 (Il4)    04660 T cell receptor signaling pathway     127219302 (Il4)    04658 Th1 and Th2 cell differentiation     127219302 (Il4)    04659 Th17 cell differentiation     127219302 (Il4)    04657 IL-17 signaling pathway     127219302 (Il4)    04664 Fc epsilon RI signaling pathway     127219302 (Il4)    04672 Intestinal immune network for IgA production     127219302 (Il4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127219302 (Il4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     127219302 (Il4)   09163 Immune disease    05310 Asthma     127219302 (Il4)    05320 Autoimmune thyroid disease     127219302 (Il4)    05321 Inflammatory bowel disease     127219302 (Il4)    05330 Allograft rejection     127219302 (Il4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127219302 (Il4)    00536 Glycosaminoglycan binding proteins [BR:prob00536]     127219302 (Il4) Cytokines and neuropeptides [BR:prob04052]  Cytokines   Interleukins    127219302 (Il4) Glycosaminoglycan binding proteins [BR:prob00536]  Heparan sulfate / Heparin   Cytokines    127219302 (Il4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  127219302 NCBI-ProteinID:  XP_051036678 UniProt:  A0AAU9Z2R4 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MGLRPQLAAILLCLLACTGNWTHGCYRGALKEIIHTLNQVTEKGTPCTEMVVPDVLTARE NSTEKDLICRASQVLRKFYFPREVTLCLKNNSEILKELKKLYRGISKFSPLKSCSVNVST YTTLKDFLESLRWIMQKKYWQCGSSTF NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgggtctcaggccccagctagctgccatcctgctctgccttctagcatgtactgggaac tggacccatggatgctacaggggagccttgaaagagatcatccacactttgaaccaggtc acagaaaaagggacaccatgcacggagatggtcgtcccagacgtccttacagcaagggag aactccacggagaaggacctcatctgcagggcttcccaggtgcttcgcaagttttatttc ccacgtgaggtgactctgtgcttgaagaacaattctgagattctcaaagagctgaaaaaa ctctacaggggcatcagcaaattctctccactgaagagctgcagtgtgaatgtgtccacg tacacaaccctgaaagacttcttggaaagcctaagatggatcatgcaaaagaaatactgg cagtgtggaagttccacgttttaa

DBGET integrated database retrieval system