Phodopus roborovskii (desert hamster): 127224840 Help Entry 127224840         CDS       T08852                                  Symbol Ifnb1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04060   Cytokine-cytokine receptor interaction prob04151   PI3K-Akt signaling pathway prob04217   Necroptosis prob04380   Osteoclast differentiation prob04620   Toll-like receptor signaling pathway prob04621   NOD-like receptor signaling pathway prob04622   RIG-I-like receptor signaling pathway prob04623   Cytosolic DNA-sensing pathway prob04630   JAK-STAT signaling pathway prob04650   Natural killer cell mediated cytotoxicity prob04668   TNF signaling pathway prob04936   Alcoholic liver disease prob05135   Yersinia infection prob05142   Chagas disease prob05152   Tuberculosis prob05160   Hepatitis C prob05161   Hepatitis B prob05162   Measles prob05163   Human cytomegalovirus infection prob05164   Influenza A prob05165   Human papillomavirus infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05168   Herpes simplex virus 1 infection prob05169   Epstein-Barr virus infection prob05170   Human immunodeficiency virus 1 infection prob05171   Coronavirus disease - COVID-19 prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     127224840 (Ifnb1)    04668 TNF signaling pathway     127224840 (Ifnb1)    04151 PI3K-Akt signaling pathway     127224840 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127224840 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     127224840 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127224840 (Ifnb1)    04621 NOD-like receptor signaling pathway     127224840 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     127224840 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     127224840 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     127224840 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     127224840 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     127224840 (Ifnb1)    05161 Hepatitis B     127224840 (Ifnb1)    05160 Hepatitis C     127224840 (Ifnb1)    05171 Coronavirus disease - COVID-19     127224840 (Ifnb1)    05164 Influenza A     127224840 (Ifnb1)    05162 Measles     127224840 (Ifnb1)    05168 Herpes simplex virus 1 infection     127224840 (Ifnb1)    05163 Human cytomegalovirus infection     127224840 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     127224840 (Ifnb1)    05169 Epstein-Barr virus infection     127224840 (Ifnb1)    05165 Human papillomavirus infection     127224840 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     127224840 (Ifnb1)    05152 Tuberculosis     127224840 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     127224840 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127224840 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     127224840 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127224840 (Ifnb1) Cytokines and neuropeptides [BR:prob04052]  Cytokines   Interferons    127224840 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  127224840 NCBI-ProteinID:  XP_051043949 UniProt:  A0AAU9ZEP8 LinkDB All DBs Position Unknown AA seq 181 aa AA seqDB search MTNRCILQAAFLLFFPTALSINYKEFELKQSSTNSVCQELLKQLHGPLCLSYRVDFKIPM EVKHPGQMEKRDAAFIIQEMLQNIFVVFNKSNFSSTGWNRTIVESFLDELHKQIGFQKEI LMEIPENGSSPTIILHLKSYYWRMQRYLEDKRYSRCAWVVTRAEVVRNFLIIERLTSIFQ N NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaggtgcatcctccaagctgcatttctgctgtttttccccacagctctgtcc atcaactacaaggagtttgagctcaaacaaagcagcactaattcagtttgtcaggagctc ctgaaacagctgcatggaccactctgcctcagctacagagtagacttcaagatccctatg gaggtgaagcacccaggacaaatggagaagagagatgctgccttcatcatccaagagatg ctccagaatatctttgttgtcttcaacaaaagcaatttctccagcactgggtggaatagg accattgttgaaagcttcttagatgaacttcataagcagataggctttcagaaggaaatt ctaatggaaatcccggagaatggaagttcgcctacaatcattctacacttgaagagctat tactggaggatgcaaaggtaccttgaagacaagaggtacagcaggtgcgcctgggtggtg acacgagcagaagtcgtaaggaactttctcatcattgaaaggcttactagtatctttcag aactga

DBGET integrated database retrieval system