Phodopus roborovskii (desert hamster): 127230991 Help Entry 127230991         CDS       T08852                                  Symbol Fos Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism prob  Phodopus roborovskii (desert hamster) Pathway prob01522   Endocrine resistance prob04010   MAPK signaling pathway prob04024   cAMP signaling pathway prob04210   Apoptosis prob04380   Osteoclast differentiation prob04620   Toll-like receptor signaling pathway prob04657   IL-17 signaling pathway prob04658   Th1 and Th2 cell differentiation prob04659   Th17 cell differentiation prob04660   T cell receptor signaling pathway prob04662   B cell receptor signaling pathway prob04668   TNF signaling pathway prob04713   Circadian entrainment prob04725   Cholinergic synapse prob04728   Dopaminergic synapse prob04915   Estrogen signaling pathway prob04917   Prolactin signaling pathway prob04921   Oxytocin signaling pathway prob04926   Relaxin signaling pathway prob04928   Parathyroid hormone synthesis, secretion and action prob04932   Non-alcoholic fatty liver disease prob04935   Growth hormone synthesis, secretion and action prob05031   Amphetamine addiction prob05132   Salmonella infection prob05133   Pertussis prob05135   Yersinia infection prob05140   Leishmaniasis prob05142   Chagas disease prob05161   Hepatitis B prob05162   Measles prob05166   Human T-cell leukemia virus 1 infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05170   Human immunodeficiency virus 1 infection prob05171   Coronavirus disease - COVID-19 prob05200   Pathways in cancer prob05207   Chemical carcinogenesis - receptor activation prob05208   Chemical carcinogenesis - reactive oxygen species prob05210   Colorectal cancer prob05224   Breast cancer prob05231   Choline metabolism in cancer prob05235   PD-L1 expression and PD-1 checkpoint pathway in cancer prob05323   Rheumatoid arthritis prob05417   Lipid and atherosclerosis prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127230991 (Fos)    04668 TNF signaling pathway     127230991 (Fos)    04024 cAMP signaling pathway     127230991 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     127230991 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127230991 (Fos)    04660 T cell receptor signaling pathway     127230991 (Fos)    04658 Th1 and Th2 cell differentiation     127230991 (Fos)    04659 Th17 cell differentiation     127230991 (Fos)    04657 IL-17 signaling pathway     127230991 (Fos)    04662 B cell receptor signaling pathway     127230991 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     127230991 (Fos)    04917 Prolactin signaling pathway     127230991 (Fos)    04921 Oxytocin signaling pathway     127230991 (Fos)    04926 Relaxin signaling pathway     127230991 (Fos)    04935 Growth hormone synthesis, secretion and action     127230991 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     127230991 (Fos)   09156 Nervous system    04725 Cholinergic synapse     127230991 (Fos)    04728 Dopaminergic synapse     127230991 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     127230991 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     127230991 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127230991 (Fos)    05207 Chemical carcinogenesis - receptor activation     127230991 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     127230991 (Fos)    05231 Choline metabolism in cancer     127230991 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     127230991 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     127230991 (Fos)    05224 Breast cancer     127230991 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     127230991 (Fos)    05170 Human immunodeficiency virus 1 infection     127230991 (Fos)    05161 Hepatitis B     127230991 (Fos)    05171 Coronavirus disease - COVID-19     127230991 (Fos)    05162 Measles     127230991 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     127230991 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     127230991 (Fos)    05135 Yersinia infection     127230991 (Fos)    05133 Pertussis     127230991 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     127230991 (Fos)    05142 Chagas disease     127230991 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     127230991 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     127230991 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127230991 (Fos)    05418 Fluid shear stress and atherosclerosis     127230991 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     127230991 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     127230991 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:prob03000]     127230991 (Fos)    04131 Membrane trafficking [BR:prob04131]     127230991 (Fos) Transcription factors [BR:prob03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     127230991 (Fos) Membrane trafficking [BR:prob04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     127230991 (Fos) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  127230991 NCBI-ProteinID:  XP_051052314 UniProt:  A0AAU9ZSL2 LinkDB All DBs Position Unknown AA seq 381 aa AA seqDB search MMFSGFNTDYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCADLSVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSTGAYSRAGMVKTVSGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEDMSVASLDLTGGLPEAATPESEEAFS LPLLNEPEPKTSLESVKSISSMELKAEPFDDFLFSASSRPSGSETTARSVPDMDLSGSFY AADWEPLHSSSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPETDSFPSCAAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctgggttcaacaccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacagcctttcctactaccattccccagcagactccttctccagcatg ggctcccctgtcaacgcacaggacttctgcgcagatctgtcagtctctagtgccaacttt atccccaccgtgacagccatctccaccagcccagacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcgcagaccagagcgccccatccctacggagtccccact ccttcgactggggcttactccagggcgggaatggtgaagaccgtgtcaggcggcagagct cagagcatcggccgaagaggcaaagtggagcagttatctcctgaagaggaagagaaacgg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaatcggaggagggaa ctgactgatactctccaagcggagacagaccaacttgaagatgagaagtctgcgttgcag accgagattgccaatctgctgaaagagaaggagaaactggagttcattttggcagcccac agacctgcctgcaagatcccggatgacctgggcttcccagaagacatgtctgtggcttcc ctggatttgactgggggtctgcctgaggctgctaccccagagtccgaggaagccttctca ctgcctctcctgaatgagcctgagcccaagacttcactggagtcagtcaagagcatcagc agtatggagctgaaggctgagccctttgatgacttcttgttctcagcatcatccaggccc agtggctctgagacgacggctcgatctgtgccagacatggacctgtccggttccttctat gcagcagactgggagcccctgcacagtagctccctggggatggggcccatggccacagag ctggaacccctgtgcaccccggtggtcacctgtactcccagctgcacaacttacacgtct tcctttgtcttcacctatccggagactgactccttccccagctgtgcagctgcccaccga aagggcagcagcagcaacgagccgtcctctgactcactcagctcacccacactgctggcc ctgtga

DBGET integrated database retrieval system