Phodopus roborovskii (desert hamster): 127231704 Help Entry 127231704         CDS       T08852                                  Name (RefSeq) cellular tumor antigen p53-like   KO K04451   tumor protein p53 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob01522   Endocrine resistance prob01524   Platinum drug resistance prob04010   MAPK signaling pathway prob04071   Sphingolipid signaling pathway prob04110   Cell cycle prob04115   p53 signaling pathway prob04137   Mitophagy - animal prob04151   PI3K-Akt signaling pathway prob04210   Apoptosis prob04211   Longevity regulating pathway prob04216   Ferroptosis prob04218   Cellular senescence prob04310   Wnt signaling pathway prob04722   Neurotrophin signaling pathway prob04919   Thyroid hormone signaling pathway prob05012   Parkinson disease prob05014   Amyotrophic lateral sclerosis prob05016   Huntington disease prob05160   Hepatitis C prob05161   Hepatitis B prob05162   Measles prob05163   Human cytomegalovirus infection prob05165   Human papillomavirus infection prob05166   Human T-cell leukemia virus 1 infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05168   Herpes simplex virus 1 infection prob05169   Epstein-Barr virus infection prob05200   Pathways in cancer prob05202   Transcriptional misregulation in cancer prob05203   Viral carcinogenesis prob05205   Proteoglycans in cancer prob05206   MicroRNAs in cancer prob05210   Colorectal cancer prob05212   Pancreatic cancer prob05213   Endometrial cancer prob05214   Glioma prob05215   Prostate cancer prob05216   Thyroid cancer prob05217   Basal cell carcinoma prob05218   Melanoma prob05219   Bladder cancer prob05220   Chronic myeloid leukemia prob05222   Small cell lung cancer prob05223   Non-small cell lung cancer prob05224   Breast cancer prob05225   Hepatocellular carcinoma prob05226   Gastric cancer prob05230   Central carbon metabolism in cancer prob05417   Lipid and atherosclerosis prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127231704    04310 Wnt signaling pathway     127231704    04071 Sphingolipid signaling pathway     127231704    04151 PI3K-Akt signaling pathway     127231704  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     127231704   09143 Cell growth and death    04110 Cell cycle     127231704    04210 Apoptosis     127231704    04216 Ferroptosis     127231704    04115 p53 signaling pathway     127231704    04218 Cellular senescence     127231704  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     127231704   09156 Nervous system    04722 Neurotrophin signaling pathway     127231704   09149 Aging    04211 Longevity regulating pathway     127231704  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127231704    05202 Transcriptional misregulation in cancer     127231704    05206 MicroRNAs in cancer     127231704    05205 Proteoglycans in cancer     127231704    05203 Viral carcinogenesis     127231704    05230 Central carbon metabolism in cancer     127231704   09162 Cancer: specific types    05210 Colorectal cancer     127231704    05212 Pancreatic cancer     127231704    05225 Hepatocellular carcinoma     127231704    05226 Gastric cancer     127231704    05214 Glioma     127231704    05216 Thyroid cancer     127231704    05220 Chronic myeloid leukemia     127231704    05217 Basal cell carcinoma     127231704    05218 Melanoma     127231704    05219 Bladder cancer     127231704    05215 Prostate cancer     127231704    05213 Endometrial cancer     127231704    05224 Breast cancer     127231704    05222 Small cell lung cancer     127231704    05223 Non-small cell lung cancer     127231704   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     127231704    05161 Hepatitis B     127231704    05160 Hepatitis C     127231704    05162 Measles     127231704    05168 Herpes simplex virus 1 infection     127231704    05163 Human cytomegalovirus infection     127231704    05167 Kaposi sarcoma-associated herpesvirus infection     127231704    05169 Epstein-Barr virus infection     127231704    05165 Human papillomavirus infection     127231704   09164 Neurodegenerative disease    05012 Parkinson disease     127231704    05014 Amyotrophic lateral sclerosis     127231704    05016 Huntington disease     127231704   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127231704    05418 Fluid shear stress and atherosclerosis     127231704   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     127231704    01522 Endocrine resistance     127231704  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:prob03000]     127231704    03036 Chromosome and associated proteins [BR:prob03036]     127231704    03400 DNA repair and recombination proteins [BR:prob03400]     127231704 Transcription factors [BR:prob03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     127231704 Chromosome and associated proteins [BR:prob03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      127231704 DNA repair and recombination proteins [BR:prob03400]  Eukaryotic type   Check point factors    Other check point factors     127231704 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_TAD P2 Motif Other DBs NCBI-GeneID:  127231704 NCBI-ProteinID:  XP_051053371 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSEYNLHEFLSTSTFPGGREEPQSDLSIELPLSQEAFSDLWKLLSPNNVLSTLPSSDSIK ELSLFENVAGWLEYPGEMLQKAAATAAAAPAEDRVTETPAPVAPAPATLCPLSSSVTCYK IYQGDYGFHLGFLNSGIATCTYSPSLNKLSCQLAKTCPVQLWVNCTPPPGTHVRAMAIYK KLQYMTEVVKFFPHHEHPSESNGLALPLHLIRVEV NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgtcagagtacaacttacatgaatttctctccacttccacgtttcctgggggaagggag gagccacaatcagatctcagcattgagctcccactgagtcaggaggcattttcagacctg tggaaactactatctccaaacaatgttctgtccaccttgccgtcatctgattccattaaa gaactgtccctgtttgagaatgttgcaggctggttagaatacccaggtgaaatgctccaa aaggcagccgccacagcagcagcggctccagcagaggaccgggtaactgagactcctgca ccagtggccccagcgccagccactctctgtcccctttcatcttctgtcacgtgctataaa atctaccagggtgactatggtttccatctgggcttcctgaactcagggattgccacttgc acgtattcgccttccctcaataagctatcctgccagctggcaaaaacatgccctgtacag ctgtgggtcaactgcacacctccacctggcacccatgtccgtgccatggccatttacaag aagttacaatacatgacagaagttgtaaaattcttccctcaccatgagcatccctctgaa agcaatggtttggctcttcctctgcatcttatccgagtggaagtatag

DBGET integrated database retrieval system