Phodopus roborovskii (desert hamster): 127231713 Help Entry 127231713         CDS       T08852                                  Symbol Il18 Name (RefSeq) interleukin-18   KO K05482   interleukin 18 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04060   Cytokine-cytokine receptor interaction prob04061   Viral protein interaction with cytokine and cytokine receptor prob04621   NOD-like receptor signaling pathway prob04623   Cytosolic DNA-sensing pathway prob05132   Salmonella infection prob05134   Legionellosis prob05135   Yersinia infection prob05143   African trypanosomiasis prob05144   Malaria prob05152   Tuberculosis prob05164   Influenza A prob05321   Inflammatory bowel disease prob05323   Rheumatoid arthritis prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127231713 (Il18)    04061 Viral protein interaction with cytokine and cytokine receptor     127231713 (Il18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     127231713 (Il18)    04623 Cytosolic DNA-sensing pathway     127231713 (Il18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     127231713 (Il18)   09171 Infectious disease: bacterial    05132 Salmonella infection     127231713 (Il18)    05135 Yersinia infection     127231713 (Il18)    05134 Legionellosis     127231713 (Il18)    05152 Tuberculosis     127231713 (Il18)   09174 Infectious disease: parasitic    05144 Malaria     127231713 (Il18)    05143 African trypanosomiasis     127231713 (Il18)   09163 Immune disease    05323 Rheumatoid arthritis     127231713 (Il18)    05321 Inflammatory bowel disease     127231713 (Il18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127231713 (Il18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127231713 (Il18) Cytokines and neuropeptides [BR:prob04052]  Cytokines   Interleukins    127231713 (Il18) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 Motif Other DBs NCBI-GeneID:  127231713 NCBI-ProteinID:  XP_051053380 LinkDB All DBs Position Unknown AA seq 194 aa AA seqDB search MAAIQEEGSCINFREMAFIDNTLYFIPEDDGDLESDYFGKLNHISTVIRNMNDQVLFVDR RKQPVFEDMTDADLGANAAQTRLIIYMYKDSDAGGLAVTLSVENEKMFTLSCKNKVISFQ EMDPPEHINDTKSDIIFFERGVPGHNKMQFESSLYKGHFLACEKEGDNFKLILKEKDENG DKSVMFTVTTLPQS NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggctgccatacaagaagaaggctcttgcatcaacttcagggaaatggcatttattgac aacacactttactttatacctgaagatgatggagacctggaatcagactactttggcaag cttaaccatataagcacagtcatacgaaatatgaatgaccaagttctcttcgttgacaga agaaagcaacctgtgtttgaggacatgactgatgctgacctaggggctaatgcagcacag accagactgataatatatatgtataaagattctgatgcagggggactggctgtaaccctc tctgtggagaatgaaaaaatgtttaccctctcctgtaagaacaaagtaatttcctttcag gaaatggatccacctgaacatatcaatgatacaaaaagcgatatcatattctttgagaga ggtgttccaggacacaacaagatgcaatttgaatcttcactgtacaaaggacactttcta gcttgtgaaaaggagggtgataatttcaaactcattttgaaagaaaaagatgaaaatggg gataaatctgtaatgttcactgttactaccttacctcaaagttag

DBGET integrated database retrieval system