Phodopus roborovskii (desert hamster): 127232102 Help Entry 127232102         CDS       T08852                                  Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04060   Cytokine-cytokine receptor interaction prob04061   Viral protein interaction with cytokine and cytokine receptor prob04062   Chemokine signaling pathway prob04064   NF-kappa B signaling pathway prob04621   NOD-like receptor signaling pathway prob04657   IL-17 signaling pathway prob04668   TNF signaling pathway prob04936   Alcoholic liver disease prob05134   Legionellosis prob05146   Amoebiasis prob05167   Kaposi sarcoma-associated herpesvirus infection prob05323   Rheumatoid arthritis prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     127232102    04668 TNF signaling pathway     127232102   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127232102    04061 Viral protein interaction with cytokine and cytokine receptor     127232102  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     127232102    04657 IL-17 signaling pathway     127232102    04062 Chemokine signaling pathway     127232102  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     127232102   09171 Infectious disease: bacterial    05134 Legionellosis     127232102   09174 Infectious disease: parasitic    05146 Amoebiasis     127232102   09163 Immune disease    05323 Rheumatoid arthritis     127232102   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127232102   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     127232102  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127232102 Cytokines and neuropeptides [BR:prob04052]  Cytokines   Chemokines    127232102 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  127232102 NCBI-ProteinID:  XP_051054026 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MAPATGSLLRASLLLLLLLLLITSRQTTGAPVANELRCQCLQTMSGVHLKNIQSLKVTPP GPHCTQTEVIATLKNGQEACLNPEAPMVQKIVQKMLKSGVRK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggccccagccaccggttcacttctccgtgcctctctgctgttgctgctgctgctgctg ctgatcaccagccgccagactacaggggctcctgtcgccaacgagctgcgctgtcagtgc ctgcagaccatgtcaggggttcacctcaaaaacatccagagcttgaaggtgacgccccca ggaccccactgcacccaaaccgaagtcatagccactctgaagaatggtcaggaagcttgc cttaaccctgaagcccccatggtccagaagattgtccaaaagatgctgaagagcggagtc cgcaagtga

DBGET integrated database retrieval system