Phodopus roborovskii (desert hamster): 127232104 Help Entry 127232104         CDS       T08852                                  Name (RefSeq) C-X-C motif chemokine 2   KO K05505   C-X-C motif chemokine 1/2/3 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04060   Cytokine-cytokine receptor interaction prob04061   Viral protein interaction with cytokine and cytokine receptor prob04062   Chemokine signaling pathway prob04064   NF-kappa B signaling pathway prob04621   NOD-like receptor signaling pathway prob04657   IL-17 signaling pathway prob04668   TNF signaling pathway prob04936   Alcoholic liver disease prob05134   Legionellosis prob05146   Amoebiasis prob05167   Kaposi sarcoma-associated herpesvirus infection prob05323   Rheumatoid arthritis prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     127232104    04668 TNF signaling pathway     127232104   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127232104    04061 Viral protein interaction with cytokine and cytokine receptor     127232104  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     127232104    04657 IL-17 signaling pathway     127232104    04062 Chemokine signaling pathway     127232104  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     127232104   09171 Infectious disease: bacterial    05134 Legionellosis     127232104   09174 Infectious disease: parasitic    05146 Amoebiasis     127232104   09163 Immune disease    05323 Rheumatoid arthritis     127232104   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127232104   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     127232104  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127232104 Cytokines and neuropeptides [BR:prob04052]  Cytokines   Chemokines    127232104 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  127232104 NCBI-ProteinID:  XP_051054027 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MAPATRSLLRASLLLLLLLLITSRQTTGAVVATELRCQCLKTISRIDFKTIQSLKVTPPG PHCTQTEVIATIKDGQEVCLDPEAPLVRRIIQKILNKGKTN NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggccccagccacccgttcactcctccgtgcctctctgctgttgctgctgctgctgctg atcaccagccgccagactacaggggcagttgtggccaccgagctgcgttgtcagtgcctg aagacgatatccaggattgatttcaagaccatccagagcttgaaggtgacacctccagga ccccactgcacccagacagaagtcatagccactatcaaggatggtcaagaagtttgcctc gaccctgaagcccccttggttcgcaggatcatccaaaagattctgaacaaaggcaagact aactga

DBGET integrated database retrieval system