Phodopus roborovskii (desert hamster): 127235558 Help Entry 127235558         CDS       T08852                                  Symbol Il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob01521   EGFR tyrosine kinase inhibitor resistance prob01523   Antifolate resistance prob04060   Cytokine-cytokine receptor interaction prob04061   Viral protein interaction with cytokine and cytokine receptor prob04066   HIF-1 signaling pathway prob04068   FoxO signaling pathway prob04151   PI3K-Akt signaling pathway prob04218   Cellular senescence prob04620   Toll-like receptor signaling pathway prob04621   NOD-like receptor signaling pathway prob04623   Cytosolic DNA-sensing pathway prob04625   C-type lectin receptor signaling pathway prob04630   JAK-STAT signaling pathway prob04640   Hematopoietic cell lineage prob04657   IL-17 signaling pathway prob04659   Th17 cell differentiation prob04668   TNF signaling pathway prob04672   Intestinal immune network for IgA production prob04931   Insulin resistance prob04932   Non-alcoholic fatty liver disease prob04933   AGE-RAGE signaling pathway in diabetic complications prob04936   Alcoholic liver disease prob05010   Alzheimer disease prob05020   Prion disease prob05022   Pathways of neurodegeneration - multiple diseases prob05132   Salmonella infection prob05133   Pertussis prob05134   Legionellosis prob05135   Yersinia infection prob05142   Chagas disease prob05143   African trypanosomiasis prob05144   Malaria prob05146   Amoebiasis prob05152   Tuberculosis prob05161   Hepatitis B prob05162   Measles prob05163   Human cytomegalovirus infection prob05164   Influenza A prob05166   Human T-cell leukemia virus 1 infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05168   Herpes simplex virus 1 infection prob05169   Epstein-Barr virus infection prob05171   Coronavirus disease - COVID-19 prob05200   Pathways in cancer prob05202   Transcriptional misregulation in cancer prob05321   Inflammatory bowel disease prob05323   Rheumatoid arthritis prob05332   Graft-versus-host disease prob05410   Hypertrophic cardiomyopathy prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     127235558 (Il6)    04668 TNF signaling pathway     127235558 (Il6)    04066 HIF-1 signaling pathway     127235558 (Il6)    04068 FoxO signaling pathway     127235558 (Il6)    04151 PI3K-Akt signaling pathway     127235558 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127235558 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     127235558 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     127235558 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     127235558 (Il6)    04620 Toll-like receptor signaling pathway     127235558 (Il6)    04621 NOD-like receptor signaling pathway     127235558 (Il6)    04623 Cytosolic DNA-sensing pathway     127235558 (Il6)    04625 C-type lectin receptor signaling pathway     127235558 (Il6)    04659 Th17 cell differentiation     127235558 (Il6)    04657 IL-17 signaling pathway     127235558 (Il6)    04672 Intestinal immune network for IgA production     127235558 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127235558 (Il6)    05202 Transcriptional misregulation in cancer     127235558 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     127235558 (Il6)    05161 Hepatitis B     127235558 (Il6)    05171 Coronavirus disease - COVID-19     127235558 (Il6)    05164 Influenza A     127235558 (Il6)    05162 Measles     127235558 (Il6)    05168 Herpes simplex virus 1 infection     127235558 (Il6)    05163 Human cytomegalovirus infection     127235558 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     127235558 (Il6)    05169 Epstein-Barr virus infection     127235558 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     127235558 (Il6)    05135 Yersinia infection     127235558 (Il6)    05133 Pertussis     127235558 (Il6)    05134 Legionellosis     127235558 (Il6)    05152 Tuberculosis     127235558 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     127235558 (Il6)    05144 Malaria     127235558 (Il6)    05142 Chagas disease     127235558 (Il6)    05143 African trypanosomiasis     127235558 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     127235558 (Il6)    05321 Inflammatory bowel disease     127235558 (Il6)    05332 Graft-versus-host disease     127235558 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     127235558 (Il6)    05020 Prion disease     127235558 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     127235558 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127235558 (Il6)    05410 Hypertrophic cardiomyopathy     127235558 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     127235558 (Il6)    04932 Non-alcoholic fatty liver disease     127235558 (Il6)    04931 Insulin resistance     127235558 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     127235558 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     127235558 (Il6)    01523 Antifolate resistance     127235558 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127235558 (Il6) Cytokines and neuropeptides [BR:prob04052]  Cytokines   Interleukins    127235558 (Il6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 DUF1137 DUF5898 Motif Other DBs NCBI-GeneID:  127235558 NCBI-ProteinID:  XP_051058849 LinkDB All DBs Position Unknown AA seq 195 aa AA seqDB search MLVMTTALPTSRVRRGDFTEDTTPNRPVYTTLQQVGGLITYALREIFEMRKELCNNNPDC MKYDDALSENNLELPVIERNDGCLQTEYNWEICLLKITSGLLDYQIYLEFVTNNVQDNKK DKARVIQSTTKTLNQIFKQEVKDPGKIVTPCPTSKALLMEKLESQKEWPRTKTIELILKA LEEFLKVTMRSTRQN NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgctggtgatgaccactgcccttcctacctcacgagtccggagaggagacttcacagag gacaccactcccaacagaccagtatataccactttgcaacaagttggaggcttgattaca tacgccctcagggaaatcttcgaaatgagaaaagagttgtgtaataacaatcccgattgt atgaagtatgatgatgcattgtcagaaaacaatctggaacttccggtgatagaaaggaat gacggatgcctccaaacagaatacaattgggaaatttgcctactgaaaatcacctctggc cttctggactaccagatctatctggagtttgtgacgaacaatgtacaagataacaagaaa gacaaagccagagtcattcagagcaccaccaaaaccctaaatcagatcttcaaacaagag gtaaaggatccaggtaaaatagtcacgccttgcccaacttccaaggccctcctaatggag aagctggagtcacagaaggagtggccaaggaccaagactatcgaactcatcctgaaagca cttgaagaattcctaaaagtcaccatgaggtctactcggcaaaactag

DBGET integrated database retrieval system