Phodopus roborovskii (desert hamster): 127237210 Help Entry 127237210         CDS       T08852                                  Name (RefSeq) CD209 antigen-like protein C   KO K06563   C-type lectin domain family 4 member L/M Organism prob  Phodopus roborovskii (desert hamster) Pathway prob03260   Virion - Human immunodeficiency virus prob03264   Virion - Flavivirus and Alphavirus prob03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus prob03273   Virion - Lassa virus and SFTS virus prob04145   Phagosome prob04625   C-type lectin receptor signaling pathway prob05152   Tuberculosis prob05162   Measles Brite KEGG Orthology (KO) [BR:prob00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     127237210    03264 Virion - Flavivirus and Alphavirus     127237210    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     127237210    03273 Virion - Lassa virus and SFTS virus     127237210  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127237210  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127237210  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     127237210   09171 Infectious disease: bacterial    05152 Tuberculosis     127237210  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prob04131]     127237210   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:prob04054]     127237210    04515 Cell adhesion molecules [BR:prob04515]     127237210    04090 CD molecules [BR:prob04090]     127237210    04091 Lectins [BR:prob04091]     127237210 Membrane trafficking [BR:prob04131]  Endocytosis   Phagocytosis    C-lectin receptors     127237210 Pattern recognition receptors [BR:prob04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    127237210 Cell adhesion molecules [BR:prob04515]  Lectins   Selectins and C-type lectins    127237210 CD molecules [BR:prob04090]  Proteins   127237210 Lectins [BR:prob04091]  C-Type lectins   Asialoglycoprotein and DC receptors    127237210 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C HipA_2 Ets Sec31 Maf_flag10_N Motif Other DBs NCBI-GeneID:  127237210 NCBI-ProteinID:  XP_051061279 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MLQLFCLALSSVLLLAVLVKVSSIANSWGQDQAKKEKIYQKMSQLKPQISRLCRHCPWDW TFFQGNCYFFSMFQQNWHDSVTACREMGAQLVIIKSEDEQSFLQQTSKEKGYAWMGLSDL KHEGVWHWVDGSHLLFSFMKYWNKGEPNNEGEEDCAEFRDDGWNDVPCTVKKYWICKKTA MTCTRK NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgctgcagctgttctgcctcgcactttcttctgttctccttctggctgtccttgtcaaa gtctccagtattgccaactcctggggacaagatcaagcaaaaaaggagaagatataccag aaaatgagccagctgaagcctcaaataagccgcctgtgccgccactgcccctgggactgg acattcttccaaggaaactgttacttcttctccatgttccaacagaactggcatgactct gtcaccgcctgcagggaaatgggagcccaactagtcatcatcaaaagtgaagatgagcag agcttcctgcagcagacttcgaaagagaaaggctatgcctggatggggctgtcagacctg aagcacgaaggtgtgtggcactgggtggatggttcacatctgctgttcagtttcatgaaa tattggaacaaaggggagcccaacaatgaaggggaagaagactgcgcagaatttagagat gatggctggaatgacgtcccgtgcacagttaagaaatactggatctgcaagaagactgct atgacctgcaccagaaaatga

DBGET integrated database retrieval system