Lathyrus oleraceus (garden pea): 127086751 Help Entry 127086751         CDS       T08598                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism psat  Lathyrus oleraceus (garden pea) Pathway psat03420   Nucleotide excision repair psat04120   Ubiquitin mediated proteolysis psat04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psat00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127086751    04120 Ubiquitin mediated proteolysis     127086751   09124 Replication and repair    03420 Nucleotide excision repair     127086751  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:psat04121]     127086751    03400 DNA repair and recombination proteins [BR:psat03400]     127086751 Enzymes [BR:psat01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      127086751 Ubiquitin system [BR:psat04121]  Ubiquitin ligases (E3)   UBL E3 ligases    127086751   Multi subunit type E3    SCF complex     Ring finger protein      127086751    Cul2 complex      127086751    Cul3 complex      127086751    Cul4 complex      127086751    Cul7 complex      127086751    Cul8 complex      127086751    Cul9 complex      127086751 DNA repair and recombination proteins [BR:psat03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       127086751     TCR (transcription coupled repair) factors      Cul4-CSA complex       127086751 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  127086751 NCBI-ProteinID:  XP_050883509 LinkDB All DBs Position 5:590269000..590272316 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVAAGESSCSHGPSSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgaccctagattccgacgtccctatggtagccgccggcgagtcctcctgctctcac ggtccctcttcttccaagaagcccaagcgcttcgagatcaagaagtggaatgctgtttct ctctgggcttgggacattgttgttgataactgcgctatctgcaggaatcatatcatggat ctttgcattgagtgtcaggcaaatcaagctagcgcaactagtgaggaatgcacagttgct tggggggtttgtaaccatgcatttcatttccattgcattagccgatggctcaagacccgt caagtttgccctctagataacagtgagtgggagtttcagaaatacggtcactaa

DBGET integrated database retrieval system