Pseudoalteromonas sp. A25: PA25_07760 Help Entry PA25_07760        CDS       T07990                                  Symbol folB Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism psaz  Pseudoalteromonas sp. A25 Pathway psaz00790   Folate biosynthesis psaz01100   Metabolic pathways psaz01240   Biosynthesis of cofactors Module psaz_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:psaz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PA25_07760 (folB) Enzymes [BR:psaz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PA25_07760 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PA25_07760 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PA25_07760 (folB) SSDB OrthologParalogGFIT Motif Pfam:  FolB DUF724 Motif Other DBs NCBI-ProteinID:  BBN80791 LinkDB All DBs Position 1:897979..898332 Genome browser AA seq 117 aa AA seqDB search MDKVYISQLHVETIIGVYDFEKESKQSLYFDIDMLTDISAAAQTDDINLAVDYAKVSERV IAHTTAKPVELLETLLEQLAALILGEFNVEQVTIRVSKPAAVREAQTVGVEITRAKR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggataaggtttatatatcacaactacacgtcgaaactataataggagtttacgacttt gaaaaggaaagtaaacaaagcttatactttgacattgatatgttgaccgatatttcggct gcagcacagactgacgatattaacctagcagttgattatgcgaaagtgagtgagcgtgtt attgcgcacaccacagccaaacctgttgagctattagaaacattattagaacagcttgca gcgttgatacttggagagtttaatgttgagcaagtcactattagagtcagtaaacctgct gcggttagagaggcgcaaacagtaggtgttgagatcaccagagcgaagcgttaa

DBGET integrated database retrieval system