KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3237
Entry
NH8B_3237         CDS       T01619                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-(acyl-carrier protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00061  Fatty acid biosynthesis
pse00780  Biotin metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01212  Fatty acid metabolism
pse01240  Biosynthesis of cofactors
Module
pse_M00083  Fatty acid biosynthesis, elongation
pse_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NH8B_3237 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NH8B_3237 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NH8B_3237 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pse01004]
    NH8B_3237 (fabG)
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     NH8B_3237 (fabG)
Lipid biosynthesis proteins [BR:pse01004]
 Fatty acid synthase
  Component type
   NH8B_3237 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Other DBs
NCBI-ProteinID: BAK78003
LinkDB
Position
complement(3418620..3419357)
AA seq 245 aa
MSLQGKVALVTGASRGIGAAIAEALAAEGAKVIGTATSEAGAAAIGERLAAQGGVGMVLN
VGEEGAIEALVDTIAKEYGDIAILVNNAGITRDGLLMRMKDEDWDAIMDTNLRSVFKASK
AVLRGMMKARWGRIVNIASVVGAMGNAGQTNYAAAKAGIMGFTKSMAREVGSRNITVNCV
APGFIDTDMTRALPEAQREMLVQQIALGRLGDAKDIADAVGFLASDRAAYITGQTLHVNG
GMLMP
NT seq 738 nt   +upstreamnt  +downstreamnt
atgagtctgcagggtaaagtggcgctggtgaccggcgcgtcccgcggcatcggtgcggcg
attgccgaagcactggccgccgagggagccaaagtcatcggcaccgccacctccgaggca
ggggccgccgccatcggcgagcgcctggcggcgcaaggcggcgtgggcatggtgctcaac
gtcggtgaagaaggggccatcgaggcgctggtcgacaccatcgccaaggaatacggcgat
atcgccatcctggtcaataacgccggcatcacccgcgacggtctcttgatgcgcatgaag
gacgaggactgggacgccatcatggacaccaacctgcgctcggtgttcaaggcctccaag
gccgtgctgcgtggcatgatgaaggcgcgctggggccgcatcgtcaacatcgcttcggtg
gtgggcgcgatgggcaacgccggccagaccaactacgcggccgccaaggccggcatcatg
ggcttcaccaagtcgatggcgcgtgaagtgggcagccgtaacatcaccgtcaactgcgtg
gcgccgggcttcatcgacaccgacatgacccgcgcactgccggaagcgcagcgcgagatg
ctggtgcagcagatcgccctgggccgcctcggcgacgccaaggacatcgccgatgccgtg
ggctttttggcatcggatcgcgcggcctacatcaccggccagacattgcatgtgaatggt
ggcatgctgatgccctaa

DBGET integrated database retrieval system