Pseudonocardia sp. AL041005-10: WY02_08920
Help
Entry
WY02_08920 CDS
T04051
Name
(GenBank) hypothetical protein
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
psea
Pseudonocardia sp. AL041005-10
Pathway
psea00061
Fatty acid biosynthesis
psea00780
Biotin metabolism
psea01100
Metabolic pathways
psea01110
Biosynthesis of secondary metabolites
psea01212
Fatty acid metabolism
psea01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
psea00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
WY02_08920
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
WY02_08920
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
WY02_08920
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
psea01004
]
WY02_08920
Enzymes [BR:
psea01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
WY02_08920
Lipid biosynthesis proteins [BR:
psea01004
]
Fatty acid synthase
Component type
WY02_08920
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
SDR
KR
Epimerase
F420_oxidored
3HCDH_N
TrkA_N
Motif
Other DBs
NCBI-ProteinID:
ALE78534
LinkDB
All DBs
Position
1992471..1993226
Genome browser
AA seq
251 aa
AA seq
DB search
MAAGSLQGKVAIVTGGASGIGRATAGRFVEEGASVVVADLDGEAAERAAAELGERAVGLR
VDVTDAAANAAAVERAEAAFGRLDLLSCNAGLTGFPVPALDADPDEFSAIFDVNVKGVWL
GVRAAVPAMRRTGGGAVTITGSVMGERTRPGFGAYASSKAAANHLARTLALELAPDIRVN
CLAPVATDTPMLPKFLGTDDPEAARERFVAGIPLARLAEAGDVADAAVFLASDAAAFLTG
VVLPVDGGRSI
NT seq
756 nt
NT seq
+upstream
nt +downstream
nt
atggccgcgggttcactgcagggcaaggtcgcgatcgtcaccgggggtgcgtccggcatc
ggccgggccacggccggccggttcgtcgaggagggggcgtcggtcgtcgtcgccgacctg
gacggggaggcggcggagcgcgccgccgccgagctcggtgagcgggcggtcgggctccgg
gtcgacgtcaccgacgccgccgcgaacgccgccgccgtcgagcgggccgaggccgcgttc
ggccggctggacctgctgtcctgcaacgccgggctcaccggcttccccgtccccgcgctc
gacgccgaccccgacgagttctcggcgatcttcgacgtcaacgtgaagggcgtctggctc
ggtgtccgcgccgcggtgcccgccatgcggcgcaccggcggcggcgcggtcacgatcacc
gggtcggtgatgggcgagcggacccgtcccgggttcggcgcctacgcctcgtcgaaggcc
gccgccaaccacctcgcccggaccctggccctggagctcgcgcccgacatccgggtcaac
tgcctggccccggtcgccaccgacaccccgatgctgccgaagttcctcggcaccgacgac
cccgaggcggcccgcgagcgcttcgtcgcgggcatcccgctggcccggctcgccgaggcg
ggcgacgtcgccgacgccgcggtgttcctcgcctccgacgccgccgcgttcctgaccggc
gtcgtcctgcccgtcgacggcgggcggagcatctga
DBGET
integrated database retrieval system