Pseudomonas sediminis: HNQ25_10900
Help
Entry
HNQ25_10900 CDS
T07154
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase LigA
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
psej
Pseudomonas sediminis
Pathway
psej03030
DNA replication
psej03410
Base excision repair
psej03420
Nucleotide excision repair
psej03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
psej00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
HNQ25_10900 (ligA)
03410 Base excision repair
HNQ25_10900 (ligA)
03420 Nucleotide excision repair
HNQ25_10900 (ligA)
03430 Mismatch repair
HNQ25_10900 (ligA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
psej03032
]
HNQ25_10900 (ligA)
03400 DNA repair and recombination proteins [BR:
psej03400
]
HNQ25_10900 (ligA)
Enzymes [BR:
psej01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
HNQ25_10900 (ligA)
DNA replication proteins [BR:
psej03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
HNQ25_10900 (ligA)
DNA repair and recombination proteins [BR:
psej03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
HNQ25_10900 (ligA)
NER (nucleotide excision repair)
GGR (global genome repair) factors
HNQ25_10900 (ligA)
MMR (mismatch excision repair)
DNA ligase
HNQ25_10900 (ligA)
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
HNQ25_10900 (ligA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
HHH_5
BRCT
Nlig-Ia
DNA_ligase_ZBD
5_3_exonuc
PTCB-BRCT
DUF4796_N
Motif
Other DBs
NCBI-ProteinID:
QNH03204
UniProt:
A0ABX6SN31
LinkDB
All DBs
Position
2340932..2343328
Genome browser
AA seq
798 aa
AA seq
DB search
MTDAAQRISELRNELDAHNYRYYVLDEPSVPDAEYDRLFRELQALEVEHPELVTPESPTQ
RVGGEALSAFGEVRHEVPMLSLGNAFEEDDLRAFDRSVQNGLGVQGGDLFGGGAEIEYSC
EPKLDGLAVSLRYENGQLVRGATRGDGSTGEDITSNVRTIRNVPLKLQGEGWPQVLEVRG
EVFMPKSGFEELNARQAEIGGKTFANPRNAAAGSLRQLDPKITASRPLEFCCYGVGQVSG
ELPGTQVAMLQQLKTWGVPISRELKLAKGVEACLDYYRDIGQRRMSLAYDIDGVVFKVNN
IEDQQQLGFRARTPHWAIAHKFPAQEELTELLDVEFQVGRTGAVTPVARLNPVKVAGVMV
ANATLHNMDEVARLGVMIGDTVIIRRAGDVIPQVMAVVPERRPDNARPVHIPEQCPVCGS
AVERTQLVKRSKGKESLSEGSVYRCVGRLSCQAQLKQAIIHFVSRRAMDIEGLGDKTIEQ
LVDEKLIASPADLYKLTFEQIIGLEGFAEVSSNKLLAAIRDSKRPTLARFIYALGIPDVG
EETAKVLARSLASLERVRKALPQVLTYLPDIGLEVAHEIHSFFEDAHNQQVISALLGECG
LELQEEGDLSAEFSAVATLGGMLDKLNIPGVGPGAAQKLAERFKTLDALIEVARLIDKDA
DGQWLKLNTLSGVNEKAKQSLRAFFANPDNQVLARAIEQQLRDFGMHWESEKKVAEGLPL
AGQTWVLTGTLEVMSRDVAKEKLESLGAKVAGSVSAKTHCVVAGPGAGSKLAKASELGVK
VLDEAQFLDQLKAYGIDL
NT seq
2397 nt
NT seq
+upstream
nt +downstream
nt
atgaccgacgccgcccaacgtatttccgaactgcgcaacgaactggacgcgcacaactac
cgttactacgtgctggacgagccgagcgtacccgacgccgagtacgatcgcctgttccgc
gaactgcaggcgctggaggttgagcatcccgaactggtaacgccggagtcgccgacccag
cgcgtcggcggtgaggcgctcagcgccttcggcgaggtgcgtcacgaagtgccgatgctt
agcctgggtaacgccttcgaggaagacgacctgcgtgccttcgaccgcagtgtgcagaat
ggccttggcgtgcagggcggtgatctgttcggcggcggcgccgagatcgagtacagctgc
gaacccaagctcgatggtctggcggtcagcctgcgctacgagaacggccagctggtgcgt
ggcgccacgcgcggagatggcagcaccggcgaagatatcaccagcaacgtacgcaccatt
cgcaatgtgccgctcaagctgcagggcgagggctggccgcaagtgctggaagtgcgtggt
gaggtgttcatgcccaagtccggcttcgaggagctcaatgcacgtcaggccgagatcggt
ggcaagactttcgccaacccacgcaacgccgctgccggcagcctgcgtcagcttgacccg
aagatcaccgccagccgcccactggagttctgttgctacggcgtcggccaggtcagcggc
gaactgccgggcacccaagtggccatgttgcagcagcttaaaacctggggcgtgcccatc
agtcgcgagctgaagctggccaagggcgtcgaggcctgcctggattactaccgcgacatc
ggtcagcgacgcatgagcctggcctatgacattgatggcgtggtgttcaaggtcaacaac
atcgaagaccagcagcaactgggcttccgtgcgcgcaccccgcactgggctattgcccac
aagttcccggcgcaggaagagctgaccgagctgctggacgtggagtttcaggtcggtcgt
actggtgcggtcacgccggttgcgcgactgaacccggtcaaggtggctggagtgatggtg
gccaatgcaaccctgcacaacatggatgaggtggcgcgcctcggcgtgatgatcggcgac
acggtgatcatccgccgtgctggcgacgtgatcccgcaggtgatggcggtggtgcccgag
cgtcgcccggataatgcgcgcccggtgcatatccccgagcaatgccctgtgtgcggttca
gccgtggagcgcacacaactggtcaagcgcagcaagggcaaggagtcgctcagcgaaggt
tcggtgtatcgctgcgtcggtcgcctgagctgtcaggcgcagctcaagcaggcgatcatc
cacttcgtctcgcgtcgcgccatggatatcgaaggcctcggcgacaagaccatcgagcaa
ctggtggacgagaagctgatcgcgtcgccagccgacctgtacaaactgaccttcgagcag
atcatcggtctggaaggcttcgccgaggtgtccagcaacaagttgctggcggccatcagg
gacagcaagcggccgaccctggcgcgctttatctacgccctggggattcccgatgtaggc
gaggaaaccgccaaggtgctggcgcgctccctggcctcgttggagcgcgtgcgcaaggcg
ctgccacaggtgctgacctacttgccggacattggtctggaagtcgcgcacgagatccac
agcttcttcgaggacgcgcacaaccagcaggtgatcagcgccttattgggcgaatgcggc
ctcgaactgcaggaggagggagacctgagcgccgagttttcggccgtcgccacccttggg
ggcatgctcgacaagctgaatattccaggtgtcggccccggagcggctcagaagttggcg
gagcgcttcaaaaccttagatgcactgatcgaggtagcgaggctgatcgacaaggatgcc
gacgggcaatggctgaagttgaacaccttgtcaggggtgaacgagaaggccaagcagtct
ttgcgagcattctttgctaatccagataatcaggttcttgcccgcgccatcgagcagcaa
ctgcgcgatttcggcatgcactgggaaagcgagaagaaagtcgctgaaggcctgcccctg
gccggccagacctgggtgctcaccggcaccctggaagtgatgagccgcgacgtggccaag
gaaaagctggagagcttgggcgccaaggtggctggttcggtgtcggccaagacccattgc
gtcgtcgcagggccgggtgccggttcgaagctggccaaggctagcgagctgggggtgaag
gtactggacgaagcgcagtttctcgaccagctcaaggcttacggcatcgacctctag
DBGET
integrated database retrieval system