Pseudomonas sp. TCU-HL1: THL1_508 Help Entry THL1_508          CDS       T05373                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pset  Pseudomonas sp. TCU-HL1 Pathway pset00790   Folate biosynthesis pset01100   Metabolic pathways pset01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:pset00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     THL1_508 Enzymes [BR:pset01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      THL1_508  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      THL1_508  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      THL1_508 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AOE83056 UniProt:  A0A1B3E0J0 LinkDB All DBs Position 565982..566335 Genome browser AA seq 117 aa AA seqDB search MDTVFIEGLEVDTVIGAYDWERSIRQCLRLDLQLGWDNRPAAAGDDLEKALDYAAVSLRI QAFAAEAQFLLVETFAERLVAVLMEEFNIPWVRLKLHKPGAVPAASSVGVEIERGCR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt gtggacacggttttcatcgaaggtctggaggtcgacaccgtaatcggtgcctatgactgg gagcgcagcattcgccagtgtctgcgcctggacctgcagctgggctgggacaaccgccct gcagcagcaggagatgaccttgagaaggcgctcgactacgcggccgtgtccctgcgcatc caggcgttcgccgccgaggcacagttcctgttggtggagaccttcgccgaacggctcgtt gccgtgctgatggaggagttcaacattccctgggttcgcctgaagctgcacaagcccggc gccgttcccgcggccagcagtgttggcgtggagatcgagcgcggatgccgctga

DBGET integrated database retrieval system