Stutzerimonas stutzeri RCH2: Psest_3677 Help Entry Psest_3677        CDS       T02391                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism psh  Stutzerimonas stutzeri RCH2 Pathway psh00790   Folate biosynthesis psh01100   Metabolic pathways psh01240   Biosynthesis of cofactors Module psh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:psh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Psest_3677 Enzymes [BR:psh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Psest_3677  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Psest_3677  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Psest_3677 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AGA88155 UniProt:  L0GRY9 LinkDB All DBs Position complement(3841887..3842240) Genome browser AA seq 117 aa AA seqDB search MDTVFIEGLEVDTVIGAYDWERGIRQCLHLDLTLGWDIRPAAENDELDKALDYAKVAAVI DQFASEARFELVETFAERLAQRLMSEFGIVWLRLRVTKPGVNARARALGVEIERGCR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt gtggacacagtcttcatcgaaggcctggaagtggatacggtaatcggcgcctatgactgg gagcggggcattcgccagtgcctgcacctggacctgacgttgggctgggacattcgtccc gccgccgagaatgatgagttggacaaggccttggactatgccaaggtcgctgccgtcatc gatcagttcgcctccgaggcacgtttcgagctggtcgagacctttgccgaacgcctggcg cagcgcctgatgagcgagttcggcatcgtctggctgcgcctgcgcgtgaccaagcccggc gtcaatgcgcgtgcccgggcgctgggtgtggagatcgaacgcggatgtcgctga

DBGET integrated database retrieval system