Phocoena sinus (vaquita): 116745739 Help Entry 116745739         CDS       T07759                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism psiu  Phocoena sinus (vaquita) Pathway psiu01522   Endocrine resistance psiu01524   Platinum drug resistance psiu04010   MAPK signaling pathway psiu04071   Sphingolipid signaling pathway psiu04110   Cell cycle psiu04115   p53 signaling pathway psiu04137   Mitophagy - animal psiu04151   PI3K-Akt signaling pathway psiu04210   Apoptosis psiu04211   Longevity regulating pathway psiu04216   Ferroptosis psiu04218   Cellular senescence psiu04310   Wnt signaling pathway psiu04722   Neurotrophin signaling pathway psiu04919   Thyroid hormone signaling pathway psiu05012   Parkinson disease psiu05014   Amyotrophic lateral sclerosis psiu05016   Huntington disease psiu05160   Hepatitis C psiu05161   Hepatitis B psiu05162   Measles psiu05163   Human cytomegalovirus infection psiu05165   Human papillomavirus infection psiu05166   Human T-cell leukemia virus 1 infection psiu05167   Kaposi sarcoma-associated herpesvirus infection psiu05168   Herpes simplex virus 1 infection psiu05169   Epstein-Barr virus infection psiu05200   Pathways in cancer psiu05202   Transcriptional misregulation in cancer psiu05203   Viral carcinogenesis psiu05205   Proteoglycans in cancer psiu05206   MicroRNAs in cancer psiu05210   Colorectal cancer psiu05212   Pancreatic cancer psiu05213   Endometrial cancer psiu05214   Glioma psiu05215   Prostate cancer psiu05216   Thyroid cancer psiu05217   Basal cell carcinoma psiu05218   Melanoma psiu05219   Bladder cancer psiu05220   Chronic myeloid leukemia psiu05222   Small cell lung cancer psiu05223   Non-small cell lung cancer psiu05224   Breast cancer psiu05225   Hepatocellular carcinoma psiu05226   Gastric cancer psiu05230   Central carbon metabolism in cancer psiu05417   Lipid and atherosclerosis psiu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116745739 (TP53)    04310 Wnt signaling pathway     116745739 (TP53)    04071 Sphingolipid signaling pathway     116745739 (TP53)    04151 PI3K-Akt signaling pathway     116745739 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     116745739 (TP53)   09143 Cell growth and death    04110 Cell cycle     116745739 (TP53)    04210 Apoptosis     116745739 (TP53)    04216 Ferroptosis     116745739 (TP53)    04115 p53 signaling pathway     116745739 (TP53)    04218 Cellular senescence     116745739 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     116745739 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     116745739 (TP53)   09149 Aging    04211 Longevity regulating pathway     116745739 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116745739 (TP53)    05202 Transcriptional misregulation in cancer     116745739 (TP53)    05206 MicroRNAs in cancer     116745739 (TP53)    05205 Proteoglycans in cancer     116745739 (TP53)    05203 Viral carcinogenesis     116745739 (TP53)    05230 Central carbon metabolism in cancer     116745739 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     116745739 (TP53)    05212 Pancreatic cancer     116745739 (TP53)    05225 Hepatocellular carcinoma     116745739 (TP53)    05226 Gastric cancer     116745739 (TP53)    05214 Glioma     116745739 (TP53)    05216 Thyroid cancer     116745739 (TP53)    05220 Chronic myeloid leukemia     116745739 (TP53)    05217 Basal cell carcinoma     116745739 (TP53)    05218 Melanoma     116745739 (TP53)    05219 Bladder cancer     116745739 (TP53)    05215 Prostate cancer     116745739 (TP53)    05213 Endometrial cancer     116745739 (TP53)    05224 Breast cancer     116745739 (TP53)    05222 Small cell lung cancer     116745739 (TP53)    05223 Non-small cell lung cancer     116745739 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116745739 (TP53)    05161 Hepatitis B     116745739 (TP53)    05160 Hepatitis C     116745739 (TP53)    05162 Measles     116745739 (TP53)    05168 Herpes simplex virus 1 infection     116745739 (TP53)    05163 Human cytomegalovirus infection     116745739 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     116745739 (TP53)    05169 Epstein-Barr virus infection     116745739 (TP53)    05165 Human papillomavirus infection     116745739 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     116745739 (TP53)    05014 Amyotrophic lateral sclerosis     116745739 (TP53)    05016 Huntington disease     116745739 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116745739 (TP53)    05418 Fluid shear stress and atherosclerosis     116745739 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     116745739 (TP53)    01522 Endocrine resistance     116745739 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:psiu03000]     116745739 (TP53)    03036 Chromosome and associated proteins [BR:psiu03036]     116745739 (TP53)    03400 DNA repair and recombination proteins [BR:psiu03400]     116745739 (TP53) Transcription factors [BR:psiu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     116745739 (TP53) Chromosome and associated proteins [BR:psiu03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      116745739 (TP53) DNA repair and recombination proteins [BR:psiu03400]  Eukaryotic type   Check point factors    Other check point factors     116745739 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer P53_TAD TAD2 CEP1-DNA_bind Motif Other DBs NCBI-GeneID:  116745739 NCBI-ProteinID:  XP_032472646 Ensembl:  ENSPSNG00000009871 UniProt:  A0A8C9E2R6 LinkDB All DBs Position 20:8749378..8761808 Genome browser AA seq 387 aa AA seqDB search MEESQAELGVEPPLSQETFSDLWKLLPENNLLSSELSPAVDDLLLSPEDVANWLDERPDE APQMPEPPAPAAPTPAAPAPATSWPLSSFVPSQKTYPGSYGFHLGFLHSGTAKSVTCTYS PALNKLFCQLAKTCPVQLWVSSPPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERCSDYSD GLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGM NRRPILTIITLEDSNGNLLGRNSFEVRVCACPGRDRRTEEENFHKKGQSCPELPTGSAKR ALPTGTSSSPPQKKKPLDGEYFTLQIRGRERFEMLRELNEALELKDAQAGKEPGESRAHS SHLKSKKGQSPSRHKKLMFKREGPDSD NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt atggaggagtcgcaggcagaactcggcgtggagccccctctgagtcaggagacgttttca gacttgtggaaactgcttcctgaaaacaaccttctgtcctctgagctctccccagccgtg gatgacctgctgctgtccccagaagacgtcgcaaactggctggatgaacgtccagatgaa gccccccaaatgccagagccccctgcgccagctgcccccaccccagccgccccagcacca gccacctcctggcccctgtcgtcctttgtcccttcccagaagacctaccctggcagctat gggttccatctaggtttcctacattccggaacagccaagtctgtaacctgcacatattcc cctgccctcaacaagctgttttgccagctggccaagacctgcccggtgcagctgtgggtc agctcaccacccccgcccggcacccgggtccgcgccatggccatctataagaagtcagag tacatgacggaggttgtgaggcgctgtccccaccatgagcgctgctctgactatagcgac ggtctggcccctcctcagcatctcatccgggtggaagggaatttacgtgctgagtatttg gacgacagaaacacttttcgacacagcgtggtggtgccctacgagccgcccgaggttggc tctgactgtaccaccatccactacaacttcatgtgtaacagctcctgcatgggaggcatg aaccggcggcccatcctcaccatcatcacactggaagactccaatggtaatctgctggga cggaacagctttgaggtgcgtgtttgtgcgtgtcctgggagagaccgccgcacagaggaa gaaaatttccacaagaaggggcagtcttgccctgagctgcccactgggagcgctaagcga gcactgcctaccggcaccagctcctctccaccgcaaaagaagaaaccactggatggagaa tatttcactcttcagatccgtgggcgtgaacgctttgagatgttacgagagctgaatgag gccttggagctgaaggatgctcaggctggaaaggagccaggggaaagcagggctcactct agccacctgaagtctaagaaggggcagtctccctcccgtcataaaaaactgatgttcaag agagaagggcctgactcagactga

DBGET integrated database retrieval system