Phocoena sinus (vaquita): 116751393 Help Entry 116751393         CDS       T07759                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04060   Cytokine-cytokine receptor interaction psiu04151   PI3K-Akt signaling pathway psiu04630   JAK-STAT signaling pathway psiu04640   Hematopoietic cell lineage psiu04657   IL-17 signaling pathway psiu04658   Th1 and Th2 cell differentiation psiu04659   Th17 cell differentiation psiu04660   T cell receptor signaling pathway psiu04664   Fc epsilon RI signaling pathway psiu04672   Intestinal immune network for IgA production psiu05140   Leishmaniasis psiu05200   Pathways in cancer psiu05310   Asthma psiu05320   Autoimmune thyroid disease psiu05321   Inflammatory bowel disease psiu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116751393 (IL4)    04151 PI3K-Akt signaling pathway     116751393 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116751393 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     116751393 (IL4)    04660 T cell receptor signaling pathway     116751393 (IL4)    04658 Th1 and Th2 cell differentiation     116751393 (IL4)    04659 Th17 cell differentiation     116751393 (IL4)    04657 IL-17 signaling pathway     116751393 (IL4)    04664 Fc epsilon RI signaling pathway     116751393 (IL4)    04672 Intestinal immune network for IgA production     116751393 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116751393 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     116751393 (IL4)   09163 Immune disease    05310 Asthma     116751393 (IL4)    05320 Autoimmune thyroid disease     116751393 (IL4)    05321 Inflammatory bowel disease     116751393 (IL4)    05330 Allograft rejection     116751393 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:psiu04052]     116751393 (IL4)    00536 Glycosaminoglycan binding proteins [BR:psiu00536]     116751393 (IL4) Cytokines and neuropeptides [BR:psiu04052]  Cytokines   Interleukins    116751393 (IL4) Glycosaminoglycan binding proteins [BR:psiu00536]  Heparan sulfate / Heparin   Cytokines    116751393 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 RHG29_45_N Motif Other DBs NCBI-GeneID:  116751393 NCBI-ProteinID:  XP_032483105 Ensembl:  ENSPSNG00000000916 UniProt:  A0A8C9AZN4 LinkDB All DBs Position 3:complement(61973710..61982772) Genome browser AA seq 133 aa AA seqDB search MGLTSQLIPMLVCLLACTSNFIHGHKCDITLQEIIKTLNILTARKNLCMELPVEDVFATT KNTTEKETFCRAGTVLRHIYRYHKCFNKPLSGLHRNLSSMANMTCSVNEAKKSTLKDFLE TLKTIMKEKYSKC NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgatcccaatgctagtctgcttactggcatgtaccagcaac ttcatccatggacacaagtgtgatattaccttacaagagatcatcaaaacgctgaacatc ctcacagcaagaaagaacttgtgcatggagctgcctgtagaagacgtctttgccaccaca aagaacacaactgagaaggaaactttctgcagggccgggactgtgcttcggcatatctac agataccacaagtgcttcaacaaacccctgagtggacttcacaggaacctcagcagcatg gcaaacatgacctgttctgtgaatgaagccaagaagagtacgttgaaagacttcttggaa acgctaaagacgattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system