Phocoena sinus (vaquita): 116760539 Help Entry 116760539         CDS       T07759                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism psiu  Phocoena sinus (vaquita) Pathway psiu03050   Proteasome psiu04060   Cytokine-cytokine receptor interaction psiu04066   HIF-1 signaling pathway psiu04217   Necroptosis psiu04350   TGF-beta signaling pathway psiu04380   Osteoclast differentiation psiu04612   Antigen processing and presentation psiu04630   JAK-STAT signaling pathway psiu04650   Natural killer cell mediated cytotoxicity psiu04657   IL-17 signaling pathway psiu04658   Th1 and Th2 cell differentiation psiu04659   Th17 cell differentiation psiu04660   T cell receptor signaling pathway psiu04940   Type I diabetes mellitus psiu05140   Leishmaniasis psiu05142   Chagas disease psiu05143   African trypanosomiasis psiu05144   Malaria psiu05145   Toxoplasmosis psiu05146   Amoebiasis psiu05152   Tuberculosis psiu05160   Hepatitis C psiu05164   Influenza A psiu05168   Herpes simplex virus 1 infection psiu05200   Pathways in cancer psiu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer psiu05321   Inflammatory bowel disease psiu05322   Systemic lupus erythematosus psiu05323   Rheumatoid arthritis psiu05330   Allograft rejection psiu05332   Graft-versus-host disease psiu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:psiu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     116760539 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     116760539 (IFNG)    04630 JAK-STAT signaling pathway     116760539 (IFNG)    04066 HIF-1 signaling pathway     116760539 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116760539 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116760539 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     116760539 (IFNG)    04612 Antigen processing and presentation     116760539 (IFNG)    04660 T cell receptor signaling pathway     116760539 (IFNG)    04658 Th1 and Th2 cell differentiation     116760539 (IFNG)    04659 Th17 cell differentiation     116760539 (IFNG)    04657 IL-17 signaling pathway     116760539 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     116760539 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116760539 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116760539 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     116760539 (IFNG)    05164 Influenza A     116760539 (IFNG)    05168 Herpes simplex virus 1 infection     116760539 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     116760539 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     116760539 (IFNG)    05144 Malaria     116760539 (IFNG)    05145 Toxoplasmosis     116760539 (IFNG)    05140 Leishmaniasis     116760539 (IFNG)    05142 Chagas disease     116760539 (IFNG)    05143 African trypanosomiasis     116760539 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     116760539 (IFNG)    05323 Rheumatoid arthritis     116760539 (IFNG)    05321 Inflammatory bowel disease     116760539 (IFNG)    05330 Allograft rejection     116760539 (IFNG)    05332 Graft-versus-host disease     116760539 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     116760539 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     116760539 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:psiu03051]     116760539 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:psiu04052]     116760539 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:psiu00536]     116760539 (IFNG) Proteasome [BR:psiu03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     116760539 (IFNG) Cytokines and neuropeptides [BR:psiu04052]  Cytokines   Interferons    116760539 (IFNG) Glycosaminoglycan binding proteins [BR:psiu00536]  Heparan sulfate / Heparin   Cytokines    116760539 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 Motif Other DBs NCBI-GeneID:  116760539 NCBI-ProteinID:  XP_032501388 Ensembl:  ENSPSNG00000005043 UniProt:  A0A8C9B7K9 LinkDB All DBs Position 10:49088158..49093081 Genome browser AA seq 166 aa AA seqDB search MKYTSYFLAFQLCVILGSSGFYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLQILENWK DESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQ IPVDDLQIQRKAISELIKVMKDLSPRSNLRKRRRSQNLFRGQRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatataccagttatttcttagcttttcagctatgcgtgattttgggttcttctggc ttttactgccaggccccattttttaaagaaatacaaaacctaaaggaatattttaatgca agtaacccagatgtagctggtggtgggcctcttttcttacaaattctggagaattggaaa gatgagagtgacaaaaaaataattcagagccaaatcgtctccttctacttcaaactcttt gaaaacttaaaaggtaaccagatcattcaaaggagcatggatatcatcaagcaggacatg tttcagaagttcttaaatggcagctctgagaaactggatgacttcaaaaagctgattcaa attccggtagatgatctgcagatccagcgcaaagccataagtgaactcatcaaagtgatg aaggacctgtcgccaagatctaacctcagaaagcggaggagaagtcagaatctgtttcga ggccagagagcgtcgaaataa

DBGET integrated database retrieval system