Pseudomonas solani: PSm6_18830 Help Entry PSm6_18830        CDS       T09213                                  Name (GenBank) hypothetical protein   KO K01737   6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50] Organism psoa  Pseudomonas solani Pathway psoa00790   Folate biosynthesis psoa01100   Metabolic pathways psoa01240   Biosynthesis of cofactors Module psoa_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:psoa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PSm6_18830  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:psoa03016]     PSm6_18830 Enzymes [BR:psoa01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.50  6-carboxytetrahydropterin synthase      PSm6_18830   4.2  Carbon-oxygen lyases    4.2.3  Acting on phosphates     4.2.3.12  6-pyruvoyltetrahydropterin synthase      PSm6_18830 Transfer RNA biogenesis [BR:psoa03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     PSm6_18830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTPS Motif Other DBs NCBI-ProteinID:  BCD85476 LinkDB All DBs Position 2095763..2095990 Genome browser AA seq 75 aa AA seqDB search MPGCRQGYKGFAQAHGNRAWTWARRQPRHDIPGLENPTSEVLAKWIWQQLKPLLPELSRI RIHETCTSGCEYRGD NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgccggggtgccggcaggggtataagggcttcgcgcaagcgcatgggaaccgagcctgg acctgggcgcgccggcagccaaggcatgacatccccggcctggagaaccccaccagcgaa gtgctcgccaagtggatctggcagcagctcaagccattgcttcccgagctcagccgcata cgcatccacgagacctgcaccagtggctgcgagtatcgcggcgactga

DBGET integrated database retrieval system