Papaver somniferum (opium poppy): 113317589 Help Entry 113317589         CDS       T05758                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism psom  Papaver somniferum (opium poppy) Pathway psom00510   N-Glycan biosynthesis psom00513   Various types of N-glycan biosynthesis psom04141   Protein processing in endoplasmic reticulum Module psom_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:psom00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     113317589    00513 Various types of N-glycan biosynthesis     113317589  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113317589 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 ECF_trnsprt Sugar_transport Phage_holin_3_3 ATP-synt_8 Dsc3_C Motif Other DBs NCBI-GeneID:  113317589 NCBI-ProteinID:  XP_026421539 LinkDB All DBs Position 10:165461713..165466041 Genome browser AA seq 78 aa AA seqDB search MAQSGKPITSPVPEAWYPTLAFFMLTIGLLLSAAFFIYEATSSKKNKSITKELITGAVTS IFLGFGSLFLLLATGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcgcaatcagggaaacccattacaagtccagttccagaagcttggtatccaacctta gcttttttcatgctgaccattggacttctgctcagtgctgctttcttcatctacgaagct acatcttccaagaaaaacaaaagcataacaaaagagcttattactggagcagtcacttct attttcttgggtttcggatctttgttcttgcttcttgccactggtgtttatgtatga

DBGET integrated database retrieval system