KEGG   Papaver somniferum (opium poppy): 113322169
Entry
113322169         CDS       T05758                                 
Name
(RefSeq) major latex protein 149-like
  KO
K01742  thebaine synthase [EC:4.2.99.24]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00950  Isoquinoline alkaloid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00944  Morphine biosynthesis, (S)-reticuline => morphine
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    113322169
Enzymes [BR:psom01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.24  thebaine synthase
     113322169
SSDB
Motif
Pfam: Bet_v_1 DUF2963 Polyketide_cyc2
Other DBs
NCBI-GeneID: 113322169
NCBI-ProteinID: XP_026425989
LinkDB
Position
11:128340690..128341932
AA seq 160 aa
MAPLGVSGLVGKLSTELEVDCDAEKYYNMYKHGEDVKKAVPHLCVDVKIISGDPTSSGCI
KEWNVNIDGKTIRSVEETTHDDETKTLRHRVFEGDVMKDFKKFDTIMVVNPKPDGNGCVV
TRSIEYEKTNENSPTPFDYLQFGHQAIEDMNKYLRDSESN
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctcctctcggtgtttcaggtttagtcgggaaactttcaactgaattggaggtcgat
tgcgatgctgaaaaatattataacatgtataagcacggagaagatgtaaaaaaggcagtt
cctcatctttgcgttgacgtcaaaattatcagtggagatccgaccagttcaggttgtatc
aaggaatggaatgttaacattgatggtaagacgattcgctcggtagaggaaaccacacac
gatgatgaaacgaaaacgttacgtcaccgtgtatttgaaggagacgtgatgaaggatttc
aagaagtttgatacgataatggtagtcaatccaaagccggatggaaatggatgtgttgtg
acaaggtcaattgagtatgaaaaaaccaacgagaattctccaactccctttgattatcta
caattcggccatcaggccattgaggacatgaacaagtacttacgcgattctgaaagtaac
tga

DBGET integrated database retrieval system