Pandoraea sputorum: NA29_17435
Help
Entry
NA29_17435 CDS
T03554
Symbol
ligA
Name
(GenBank) DNA ligase (NAD(+)) LigA
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
pspu
Pandoraea sputorum
Pathway
pspu03030
DNA replication
pspu03410
Base excision repair
pspu03420
Nucleotide excision repair
pspu03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
pspu00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
NA29_17435 (ligA)
03410 Base excision repair
NA29_17435 (ligA)
03420 Nucleotide excision repair
NA29_17435 (ligA)
03430 Mismatch repair
NA29_17435 (ligA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
pspu03032
]
NA29_17435 (ligA)
03400 DNA repair and recombination proteins [BR:
pspu03400
]
NA29_17435 (ligA)
Enzymes [BR:
pspu01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
NA29_17435 (ligA)
DNA replication proteins [BR:
pspu03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
NA29_17435 (ligA)
DNA repair and recombination proteins [BR:
pspu03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
NA29_17435 (ligA)
NER (nucleotide excision repair)
GGR (global genome repair) factors
NA29_17435 (ligA)
MMR (mismatch excision repair)
DNA ligase
NA29_17435 (ligA)
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
NA29_17435 (ligA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
HHH_5
DNA_ligase_ZBD
Nlig-Ia
PTCB-BRCT
HHH
5_3_exonuc
BRCT_2
Motif
Other DBs
NCBI-ProteinID:
AJC17309
LinkDB
All DBs
Position
complement(3018611..3020659)
Genome browser
AA seq
682 aa
AA seq
DB search
MRNELARHNRAYYEDDAPLIPDAEYDRLFGELVALENAYPELQRADSPTQRVGGKPVDGF
APVVHRVPMLSLNNGFADEDVEAFDRRVSDGLRPDAVGAAGAGNASSGDLFGAPVEYAAE
LKFDGLAIALRYEQGVLVQAATRGDGTTGEDVTANIRTIKKIPLKLESENPPEVLEVRGE
VLMFRADFDKLNEAQEAAGEKVFVNPRNAAAGSLRQLDSKITAKRPLSFFAYGVGELVGV
PMPETHSALLDWYVTLGIPVNDKREVVQGAQGLLKFYREVGDARASLPYDIDGVVYKVNR
RDEQDRLGFVSRAPRFALAHKFPAQEALTTLLDIEVQVGRTGAITPVARLAPVFVGGATV
TNATLHNEDEIRRKDVMIGDTVIVRRAGDVIPEVVGSVLDRRPDDARAFVMPTECPVCGS
AIEKLPDEAIARCTGGLICAAQRKQALLHFAQRRALDIEGLGDKLVEQLVDQQIIRTPAD
LFKLGVAKLAALDRMADKSASNLVAALETARHTTLARFIFALGIRHVGEATAKDLARHFG
KLDNLIAVCKRDSDLTELLAVPDVGPIVAESINNFFCEDHNVEVIEQLRAAGVTWPESEP
AAVAPLPLAGKTFVLTGTLPTLSRDEAKAMLEAQGAKVAGSVSAKTDYVVAGAEAGSKLA
KAEALGVPVLDEDAMRAMLAAL
NT seq
2049 nt
NT seq
+upstream
nt +downstream
nt
ttgcgtaacgagctagcccgccacaaccgcgcttattacgaagacgacgcgccgctcatt
cccgacgcggagtatgaccgtctctttggcgaactcgtcgcgctggaaaacgcatatccc
gagttgcaacgggccgattcgcccacccagcgtgtcggcggtaagccagtcgacggattc
gcaccagtggtgcaccgtgtgccgatgctttcgctcaacaacgggttcgccgatgaggac
gtcgaggcgttcgaccgacgagtgagtgacggtctgcgtcccgatgcggtgggtgctgcc
ggggcgggtaatgcgtcgtctggcgacctgtttggtgcgccggtcgaatatgccgccgag
ctgaagttcgacggtctggccatcgcgttgcgttacgagcaaggcgtgctcgtgcaagcc
gcgacgcgcggcgacggcacgacgggcgaagatgtcaccgccaacatccgcaccatcaag
aaaatccccctcaagctcgagagcgagaatccgcctgaggtgctcgaagtgcgcggtgaa
gtgctgatgttccgcgccgacttcgacaagcttaatgaggcgcaggaggcggctggcgag
aaggttttcgttaacccgcgcaatgcggctgccggaagtctgcgccagctcgattcgaag
attacggccaagcgcccgttgtcgttcttcgcctatggcgtgggggaactggttggcgtg
ccgatgccggagacgcactcggccttgctcgattggtatgtgacgctgggtattccggtc
aacgacaagcgggaagtcgtgcagggtgcgcaaggactgctgaagttttaccgtgaagtc
ggtgatgcgcgcgcctcattgccttacgacatcgacggcgtggtctacaaggtcaaccgt
cgcgacgagcaggatcgtctcggcttcgtctcgcgcgccccgcgctttgcattggcgcac
aaatttccggcgcaggaagcgctgacgacattgctcgacattgaagtgcaagtggggcgt
acgggggcgatcacgccggtggcgcgactcgcgccggtgttcgttggcggtgcgacggtg
acgaatgccacgctgcacaacgaggacgaaattcgtcgcaaggacgtgatgatcggcgat
acggtgattgtgcgtcgcgcgggcgatgtgattcccgaagtggtcggatcggtgctggat
cgtcgtccggacgacgcgcgcgctttcgtcatgcccactgagtgtccggtctgtggttcc
gccatcgagaagctcccggacgaagcgatcgcacgatgcaccggcgggctgatttgcgcc
gcacagcgcaagcaggcgttgctgcacttcgcgcagcgtcgcgcgctcgatatcgagggg
ctcggtgacaagctggtggagcaactggtcgatcagcagatcattcggaccccggccgac
ctgttcaaactgggcgttgcaaagctcgctgcgctcgaccggatggccgacaagtcggct
tccaatctcgtcgcggcgctggagacggcgcgtcataccacgctggcgcgatttatcttt
gcactgggcattcgtcacgttggtgaagcgacggcgaaggatctcgcgcggcatttcggc
aagctcgacaacctgatcgccgtgtgcaaacgcgattccgatttgacggaactgctggcc
gttccggacgtcggaccgattgtggccgagtcgatcaacaatttcttctgcgaagatcat
aatgtcgaagtgatcgagcaactgcgggcggcgggggtcacctggccggagtcggaaccg
gcggccgttgcgccgttgccgctggcgggcaagacgtttgtgttgaccggaacattgccg
acgctctcgcgagacgaagcgaaggcgatgctcgaagcacaaggagcaaaggttgctggc
tcggtgtctgcgaaaacggactacgtggtcgcgggcgcagaggcgggcagcaagttggca
aaggccgaagcactgggtgtgcccgtgctcgacgaggacgctatgcgcgcgatgttggcc
gcgctttga
DBGET
integrated database retrieval system