Pantoea stewartii subsp. stewartii: DSJ_06060 Help Entry DSJ_06060         CDS       T04970                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism pstw  Pantoea stewartii subsp. stewartii Pathway pstw00670   One carbon pool by folate pstw00790   Folate biosynthesis pstw01100   Metabolic pathways pstw01240   Biosynthesis of cofactors pstw04981   Folate transport and metabolism Module pstw_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pstw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     DSJ_06060 (folA)    00670 One carbon pool by folate     DSJ_06060 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     DSJ_06060 (folA) Enzymes [BR:pstw01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      DSJ_06060 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  ARF48945 UniProt:  H3R8F7 LinkDB All DBs Position 1244700..1245182 Genome browser AA seq 160 aa AA seqDB search MISLIAALAADRIIGMENAMPWDLPADLAWFKRNTLKKPVIMGRLTFESIGRPLPGRLNI VVSSKPGHAEGVTWVTSLDDAVNAAGEAEEIMVIGGGRIYEQMLARADRLYLTHIDAEVE GDTQFPDYEPDEWHSTFSEFHDADEQNSHSYCFEILERRR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattagtcttatcgcggcattagcagcagatcgcattattggaatggaaaacgccatg ccgtgggacctgcctgcagatctggcgtggtttaagcgcaacacactgaaaaagcccgtc attatgggcaggctgacttttgaatcgattggccggcctttaccgggccggttgaatatt gtggtcagcagtaaacccggtcacgcagaaggcgttacctgggtaacgtcgctggatgac gcagtaaatgctgcgggcgaagctgaagagatcatggtcattggcggcggccgcatttat gaacagatgttagcccgcgctgaccgcctttatctgacgcatattgatgctgaagtagaa ggggatacccagttcccggactacgaaccggatgaatggcattctacctttagcgaattc catgacgctgacgagcagaattcgcacagctactgcttcgagatcctcgaacgacgtcgt taa

DBGET integrated database retrieval system