KEGG   Phytohabitans suffuscus: Psuf_059690
Entry
Psuf_059690       CDS       T06545                                 

Definition
(GenBank) iron/ascorbate oxidoreductase
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
psuu  Phytohabitans suffuscus
Pathway
psuu00311  Penicillin and cephalosporin biosynthesis
psuu01100  Metabolic pathways
psuu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psuu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Psuf_059690
Enzymes [BR:psuu01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     Psuf_059690
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-ProteinID: BCB88656
UniProt: A0A6F8YRH1
LinkDB
Position
complement(6420830..6421825)
AA seq 331 aa
MNEPANAPTIDISPLTGDDPQAKLRVAKEIDTACRGSGFFYAAGHGINVHRLQDVVERFH
GTMTDEEKFRLAINAYNKANPHVRNGYYMAVPGRKAVESFCYLNPSFTPDHPQIKAGTPM
HEVNWWPDETAHPGFRAYCEQYFQEMLDLSLVLLRGFALALGKPERYFDAHVTAADTLSA
VSLIRYPRLEHYPPVKTGPDGRALSFEDHQDVSLITVLFQTPVPNLQVETAEGWLDVPVS
ADDFLINCGTFMAHLTNGWYPAPNHRVTFINAARLSLPFFVHTGNESILEPFHPDGSPST
DGPSAEGNRAVRYGDYLQNGLQALIDKNGQT
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaacgagccagccaacgcccccaccatcgacatctcgccgctgaccggcgacgacccg
caagccaagctcagggtcgcgaaggagatcgacaccgcctgccgcggctccggcttcttc
tacgcagccggccacggcatcaacgtccaccgcctgcaggacgtggtggagcggttccac
ggcacgatgaccgacgaggagaagttccggctcgcgatcaacgcctacaacaaggccaac
ccgcatgtgcgcaacgggtactacatggcggttcccggccgcaaggcggtcgagtcgttc
tgctatctgaacccgtccttcaccccggaccacccccagatcaaggcggggaccccgatg
cacgaggtcaactggtggccggacgagacggcccaccccggtttccgggcgtactgtgag
cagtacttccaggagatgctcgacctgtcgctggtgctgctgcgcgggttcgccctggcg
ctgggcaagccggagcgatacttcgacgcccacgtcaccgcggcggacacgctctccgcg
gtctcgctgatccgctatccccggctcgagcattacccgccggtcaagaccggccccgac
ggtcgcgctctgagcttcgaggaccaccaggacgtctcgctgatcaccgtgctgttccag
acaccggtgcccaacctgcaggtggagaccgccgagggttggctggacgtcccggtctcc
gcggacgactttctgatcaactgcgggaccttcatggcgcacctgaccaacggctggtac
ccggcgccgaaccaccgggtgacgttcatcaacgcggcgcggctgtcgttgccgttcttc
gtgcacacaggcaacgaaagtatcctcgagccgttccatccggacggttcgccgtcgacc
gacggaccgtccgccgagggcaaccgggccgtccggtacggcgactacctgcaaaacggg
ctccaagcgctgatcgacaagaacggccagacctga

DBGET integrated database retrieval system