Desulfovibrio mangrovi: N1030_01970
Help
Entry
N1030_01970 CDS
T08614
Symbol
fabG
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
psyf
Desulfovibrio mangrovi
Pathway
psyf00061
Fatty acid biosynthesis
psyf00780
Biotin metabolism
psyf01100
Metabolic pathways
psyf01110
Biosynthesis of secondary metabolites
psyf01212
Fatty acid metabolism
psyf01240
Biosynthesis of cofactors
Module
psyf_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
psyf00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
N1030_01970 (fabG)
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
N1030_01970 (fabG)
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
N1030_01970 (fabG)
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
psyf01004
]
N1030_01970 (fabG)
Enzymes [BR:
psyf01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
N1030_01970 (fabG)
Lipid biosynthesis proteins [BR:
psyf01004
]
Fatty acid synthase
Component type
N1030_01970 (fabG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
Epimerase
Transposon_TraM
LytR_C
Motif
Other DBs
NCBI-ProteinID:
UZP67761
LinkDB
All DBs
Position
complement(422454..423197)
Genome browser
AA seq
247 aa
AA seq
DB search
MTELLSTALVTGGSRGIGKAIAQTLGKAGFQVYLTYVSKPEEAQAVAQSIIDAGGKASAF
KLNVGNAEEVNDFFKNEIKDKVRLDVLVNNAGITKDGLVLRMKDEDFDSVIGINLRGAFI
AAREAAKLMTKQRYGRIVNITSVVGQMGNAGQANYSAAKAGLIGLTKALGKELAARNVTV
NAVAPGFIETDMTQALPEAVRTEYQNAIPMKRFGSVDDIAEAVAFLASEKAGYITGQVLA
VNGGMYC
NT seq
744 nt
NT seq
+upstream
nt +downstream
nt
atgactgaactactttctacagcactggtaaccggcggctcccgagggataggaaaagcc
atcgcccagactctgggcaaagccggttttcaggtgtacctgacctacgtttccaagccc
gaggaagcgcaggccgttgcccagtccatcatcgacgcaggaggcaaggcctctgccttc
aagctgaacgtgggcaacgctgaagaagtgaacgacttcttcaagaatgaaatcaaggac
aaggtgcgccttgacgtgctcgtgaacaacgcgggcattaccaaggacggtctcgttctc
cgcatgaaggacgaggactttgacagcgtcatcggcatcaaccttcgcggcgcattcatt
gccgcacgcgaggctgccaagctcatgaccaagcagcgctacggccgcatcgtcaacatc
acctccgttgtggggcagatgggcaatgccggtcaggccaactactccgccgccaaagcc
ggccttatcggccttaccaaggctctgggcaaggaacttgccgcgcgcaacgtcactgtc
aacgccgtagctcccggttttatcgaaaccgacatgacccaggcccttccggaagccgtt
cgtaccgagtaccagaacgccattcccatgaagcgcttcggctctgtggacgatattgcg
gaagcagtcgccttcctcgcctctgagaaggcaggttacatcaccggtcaggtacttgcg
gtgaacggcggcatgtactgctaa
DBGET
integrated database retrieval system