KEGG   Desulfovibrio mangrovi: N1030_01970
Entry
N1030_01970       CDS       T08614                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
psyf  Desulfovibrio mangrovi
Pathway
psyf00061  Fatty acid biosynthesis
psyf00780  Biotin metabolism
psyf01100  Metabolic pathways
psyf01110  Biosynthesis of secondary metabolites
psyf01212  Fatty acid metabolism
psyf01240  Biosynthesis of cofactors
Module
psyf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:psyf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    N1030_01970 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    N1030_01970 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    N1030_01970 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psyf01004]
    N1030_01970 (fabG)
Enzymes [BR:psyf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     N1030_01970 (fabG)
Lipid biosynthesis proteins [BR:psyf01004]
 Fatty acid synthase
  Component type
   N1030_01970 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR Epimerase Transposon_TraM LytR_C
Other DBs
NCBI-ProteinID: UZP67761
LinkDB
Position
complement(422454..423197)
AA seq 247 aa
MTELLSTALVTGGSRGIGKAIAQTLGKAGFQVYLTYVSKPEEAQAVAQSIIDAGGKASAF
KLNVGNAEEVNDFFKNEIKDKVRLDVLVNNAGITKDGLVLRMKDEDFDSVIGINLRGAFI
AAREAAKLMTKQRYGRIVNITSVVGQMGNAGQANYSAAKAGLIGLTKALGKELAARNVTV
NAVAPGFIETDMTQALPEAVRTEYQNAIPMKRFGSVDDIAEAVAFLASEKAGYITGQVLA
VNGGMYC
NT seq 744 nt   +upstreamnt  +downstreamnt
atgactgaactactttctacagcactggtaaccggcggctcccgagggataggaaaagcc
atcgcccagactctgggcaaagccggttttcaggtgtacctgacctacgtttccaagccc
gaggaagcgcaggccgttgcccagtccatcatcgacgcaggaggcaaggcctctgccttc
aagctgaacgtgggcaacgctgaagaagtgaacgacttcttcaagaatgaaatcaaggac
aaggtgcgccttgacgtgctcgtgaacaacgcgggcattaccaaggacggtctcgttctc
cgcatgaaggacgaggactttgacagcgtcatcggcatcaaccttcgcggcgcattcatt
gccgcacgcgaggctgccaagctcatgaccaagcagcgctacggccgcatcgtcaacatc
acctccgttgtggggcagatgggcaatgccggtcaggccaactactccgccgccaaagcc
ggccttatcggccttaccaaggctctgggcaaggaacttgccgcgcgcaacgtcactgtc
aacgccgtagctcccggttttatcgaaaccgacatgacccaggcccttccggaagccgtt
cgtaccgagtaccagaacgccattcccatgaagcgcttcggctctgtggacgatattgcg
gaagcagtcgccttcctcgcctctgagaaggcaggttacatcaccggtcaggtacttgcg
gtgaacggcggcatgtactgctaa

DBGET integrated database retrieval system