Primulina tabacum: 142505744 Help Entry 142505744         CDS       T11246                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ptab  Primulina tabacum Pathway ptab03420   Nucleotide excision repair ptab04120   Ubiquitin mediated proteolysis ptab04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ptab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     142505744    04120 Ubiquitin mediated proteolysis     142505744   09124 Replication and repair    03420 Nucleotide excision repair     142505744  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ptab04121]     142505744    03400 DNA repair and recombination proteins [BR:ptab03400]     142505744 Enzymes [BR:ptab01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      142505744 Ubiquitin system [BR:ptab04121]  Ubiquitin ligases (E3)   UBL E3 ligases    142505744   Multi subunit type E3    SCF complex     Ring finger protein      142505744    Cul2 complex      142505744    Cul3 complex      142505744    Cul4 complex      142505744    Cul7 complex      142505744    Cul8 complex      142505744    Cul9 complex      142505744 DNA repair and recombination proteins [BR:ptab03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       142505744     TCR (transcription coupled repair) factors      Cul4-CSA complex       142505744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  142505744 NCBI-ProteinID:  XP_075474960 LinkDB All DBs Position 10:9176287..9179178 Genome browser AA seq 127 aa AA seqDB search MASLDTDVNMIPAGEGSSDAGPSNAAPTSAPSLSAKKAKRFEIKKWNAVALWAWDIVVDN CAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEW EFQKYGH NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgttggacaccgacgtgaatatgatccccgccggagaggggtcttccgatgct gggccctccaacgctgctcccacgtcagcgccgtcgctatccgccaagaaagccaagcga tttgagatcaagaagtggaacgccgtcgctctctgggcttgggatattgtggttgataat tgtgctatttgcaggaatcatattatggatctttgcatcgagtgtcaggctaatcaagct agtgcgaccagtgaggagtgcacggttgcttggggtgtttgcaatcatgccttccatttc cactgcatcagcagatggctcaagactcgccaagtttgccccttggacaatagtgagtgg gagtttcagaagtatggtcactaa

DBGET integrated database retrieval system