Pyrenophora teres: PTT_16968 Help Entry PTT_16968         CDS       T01613                                  Name (GenBank) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pte  Pyrenophora teres Pathway pte03420   Nucleotide excision repair pte04111   Cell cycle - yeast pte04120   Ubiquitin mediated proteolysis pte04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pte00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     PTT_16968    04120 Ubiquitin mediated proteolysis     PTT_16968   09124 Replication and repair    03420 Nucleotide excision repair     PTT_16968  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     PTT_16968  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pte04121]     PTT_16968    03400 DNA repair and recombination proteins [BR:pte03400]     PTT_16968 Enzymes [BR:pte01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      PTT_16968 Ubiquitin system [BR:pte04121]  Ubiquitin ligases (E3)   UBL E3 ligases    PTT_16968   Multi subunit type E3    SCF complex     Ring finger protein      PTT_16968    Cul2 complex      PTT_16968    Cul3 complex      PTT_16968    Cul4 complex      PTT_16968    Cul7 complex      PTT_16968    Cul8 complex      PTT_16968    Cul9 complex      PTT_16968 DNA repair and recombination proteins [BR:pte03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       PTT_16968     TCR (transcription coupled repair) factors      Cul4-CSA complex       PTT_16968 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-ProteinID:  EFQ87525 UniProt:  E3S3D4 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MADIDMADAPPAKTKTAKAGASGEGDKKRFEWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGR NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcggatatcgacatggcagatgcgcccccagccaagacgaagacggccaaggccggt gccagcggagagggcgacaagaagcgcttcgaatggaacgccgtcgcgctgtgggcgtgg gacattgtcgtagacaactgcgccatttgccgtaatcacatcatggacctctgcattgag tgccaggccaaccaagcgtcggcgacaagcgaggagtgcaccgtggcatggggaatctgc aatcacgccttccacttccactgcatctcacgatggctcaagacccgacaagtctgcccg ctcgacaaccgagactgggaattccagaagtacggccgatag

DBGET integrated database retrieval system