Puntigrus tetrazona (Sumatra barb): 122343501 Help Entry 122343501         CDS       T08985                                  Symbol rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism ptet  Puntigrus tetrazona (Sumatra barb) Pathway ptet04010   MAPK signaling pathway ptet04510   Focal adhesion ptet04517   IgSF CAM signaling ptet04520   Adherens junction Brite KEGG Orthology (KO) [BR:ptet00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122343501 (rap1b)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     122343501 (rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     122343501 (rap1b)    04520 Adherens junction     122343501 (rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptet04147]     122343501 (rap1b)    04031 GTP-binding proteins [BR:ptet04031]     122343501 (rap1b) Exosome [BR:ptet04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122343501 (rap1b)   Exosomal proteins of other body fluids (saliva and urine)    122343501 (rap1b)   Exosomal proteins of colorectal cancer cells    122343501 (rap1b) GTP-binding proteins [BR:ptet04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     122343501 (rap1b) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  122343501 NCBI-ProteinID:  XP_043093940 LinkDB All DBs Position 4:complement(9587996..9632618) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNSCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatacaagttagtagtcctcggatcaggaggtgtcggcaagtctgcgctgact gttcagtttgtccaagggatctttgtggaaaagtatgaccccacaatagaagactcatac agaaagcaagtggaggtggacggacagcagtgtatgttggaaattctggatactgccgga acggaacaattcacagccatgagagacctgtacatgaagaacggccagggctttgcacta gtatactccataacggcacagtccaccttcaacgacctgcaggacttgagagaacagatc ctgcgggtcaaagacacggatgacgtgccaatgatcctggtgggtaataagtgtgatctg gaagacgagagggtggtgggaaaggagcagggccagaatctggcccgtcagtggaacagc tgtgctttcctggagtcctctgcgaaatccaagattaacgtcaatgagatcttctatgac ctggtccggcaaatcaacaggaaaactcccgtacctggaaaggcacgcaaaaagtccacc tgccagctcctctaa

DBGET integrated database retrieval system