Panthera tigris altaica (Amur tiger): 102958919 Help Entry 102958919         CDS       T02988                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01523   Antifolate resistance ptg04010   MAPK signaling pathway ptg04060   Cytokine-cytokine receptor interaction ptg04061   Viral protein interaction with cytokine and cytokine receptor ptg04064   NF-kappa B signaling pathway ptg04071   Sphingolipid signaling pathway ptg04150   mTOR signaling pathway ptg04210   Apoptosis ptg04217   Necroptosis ptg04350   TGF-beta signaling pathway ptg04380   Osteoclast differentiation ptg04612   Antigen processing and presentation ptg04620   Toll-like receptor signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04622   RIG-I-like receptor signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04640   Hematopoietic cell lineage ptg04650   Natural killer cell mediated cytotoxicity ptg04657   IL-17 signaling pathway ptg04660   T cell receptor signaling pathway ptg04664   Fc epsilon RI signaling pathway ptg04668   TNF signaling pathway ptg04920   Adipocytokine signaling pathway ptg04930   Type II diabetes mellitus ptg04931   Insulin resistance ptg04932   Non-alcoholic fatty liver disease ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg04936   Alcoholic liver disease ptg04940   Type I diabetes mellitus ptg05010   Alzheimer disease ptg05014   Amyotrophic lateral sclerosis ptg05020   Prion disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05132   Salmonella infection ptg05133   Pertussis ptg05134   Legionellosis ptg05135   Yersinia infection ptg05140   Leishmaniasis ptg05142   Chagas disease ptg05143   African trypanosomiasis ptg05144   Malaria ptg05145   Toxoplasmosis ptg05146   Amoebiasis ptg05152   Tuberculosis ptg05160   Hepatitis C ptg05161   Hepatitis B ptg05163   Human cytomegalovirus infection ptg05164   Influenza A ptg05165   Human papillomavirus infection ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05170   Human immunodeficiency virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05205   Proteoglycans in cancer ptg05310   Asthma ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05410   Hypertrophic cardiomyopathy ptg05414   Dilated cardiomyopathy ptg05417   Lipid and atherosclerosis ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102958919 (TNF)    04350 TGF-beta signaling pathway     102958919 (TNF)    04064 NF-kappa B signaling pathway     102958919 (TNF)    04668 TNF signaling pathway     102958919 (TNF)    04071 Sphingolipid signaling pathway     102958919 (TNF)    04150 mTOR signaling pathway     102958919 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102958919 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     102958919 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102958919 (TNF)    04217 Necroptosis     102958919 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102958919 (TNF)    04620 Toll-like receptor signaling pathway     102958919 (TNF)    04621 NOD-like receptor signaling pathway     102958919 (TNF)    04622 RIG-I-like receptor signaling pathway     102958919 (TNF)    04625 C-type lectin receptor signaling pathway     102958919 (TNF)    04650 Natural killer cell mediated cytotoxicity     102958919 (TNF)    04612 Antigen processing and presentation     102958919 (TNF)    04660 T cell receptor signaling pathway     102958919 (TNF)    04657 IL-17 signaling pathway     102958919 (TNF)    04664 Fc epsilon RI signaling pathway     102958919 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102958919 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     102958919 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102958919 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102958919 (TNF)    05170 Human immunodeficiency virus 1 infection     102958919 (TNF)    05161 Hepatitis B     102958919 (TNF)    05160 Hepatitis C     102958919 (TNF)    05171 Coronavirus disease - COVID-19     102958919 (TNF)    05164 Influenza A     102958919 (TNF)    05168 Herpes simplex virus 1 infection     102958919 (TNF)    05163 Human cytomegalovirus infection     102958919 (TNF)    05169 Epstein-Barr virus infection     102958919 (TNF)    05165 Human papillomavirus infection     102958919 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     102958919 (TNF)    05135 Yersinia infection     102958919 (TNF)    05133 Pertussis     102958919 (TNF)    05134 Legionellosis     102958919 (TNF)    05152 Tuberculosis     102958919 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     102958919 (TNF)    05144 Malaria     102958919 (TNF)    05145 Toxoplasmosis     102958919 (TNF)    05140 Leishmaniasis     102958919 (TNF)    05142 Chagas disease     102958919 (TNF)    05143 African trypanosomiasis     102958919 (TNF)   09163 Immune disease    05310 Asthma     102958919 (TNF)    05322 Systemic lupus erythematosus     102958919 (TNF)    05323 Rheumatoid arthritis     102958919 (TNF)    05321 Inflammatory bowel disease     102958919 (TNF)    05330 Allograft rejection     102958919 (TNF)    05332 Graft-versus-host disease     102958919 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     102958919 (TNF)    05014 Amyotrophic lateral sclerosis     102958919 (TNF)    05020 Prion disease     102958919 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     102958919 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102958919 (TNF)    05418 Fluid shear stress and atherosclerosis     102958919 (TNF)    05410 Hypertrophic cardiomyopathy     102958919 (TNF)    05414 Dilated cardiomyopathy     102958919 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102958919 (TNF)    04940 Type I diabetes mellitus     102958919 (TNF)    04936 Alcoholic liver disease     102958919 (TNF)    04932 Non-alcoholic fatty liver disease     102958919 (TNF)    04931 Insulin resistance     102958919 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     102958919 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102958919 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102958919 (TNF)    00536 Glycosaminoglycan binding proteins [BR:ptg00536]     102958919 (TNF) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Tumor necrosis fators    102958919 (TNF) Glycosaminoglycan binding proteins [BR:ptg00536]  Heparan sulfate / Heparin   Cytokines    102958919 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  102958919 NCBI-ProteinID:  XP_007098870 UniProt:  A0A8C9KHC3 LinkDB All DBs Position Un AA seq 306 aa AA seqDB search MQLSAHPVSRSFLSEDTRGPARRETEATPDPPGNNISDDTPPDKQPGDSLPLTHTALGLY HHPAGLEPPGKNAMSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTL FCLLHFGVIGPQREELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQWLSR RANALLANGVELTDNQLKVPSDGLYLIYSQVLFTGQGCPSTHVLLTHTISRFAVSYQTKV NLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVY FGIIAL NT seq 921 nt NT seq  +upstreamnt  +downstreamnt atgcagctgtctgcacacccagtcagcagaagcttcctcagcgaagacaccaggggacca gccaggagagagacagaagcaactccagacccccccggaaataacatctcagacgacaca cccccagacaagcagccaggcgattctctccctctcacacacactgccttagggctctac catcacccagctggacttgagccccctgggaagaacgccatgagcactgaaagcatgatc cgggacgtggagctggccgaggaggcactccccaagaaggcagggggcccccagggctcc agaaggtgcttgtgcctcagcctcttctccttcctcctcgtcgcaggagccaccacactc ttctgcctgctgcactttggagtgatcggcccccagagggaagagctcccacatggcctg caactaatcaaccctctgccccagacactcagatcatcttctcgaactccgagtgacaag ccagtagcccatgtagtagcaaaccccgaagctgaagggcaactccagtggctgagccgg cgtgccaatgccctcctggccaatggcgtggagctgacagacaaccagctgaaggtgccc tcagacgggctgtacctcatctactcccaggtcctcttcacgggccaaggatgtccttcc acacatgtgctcctcacccacaccatcagccgctttgccgtttcctaccagaccaaggtc aacctcctctctgccatcaagagcccttgccagagggagaccccagagggggctgaggcc aagccctggtatgagcccatctacctgggaggggtcttccaactggagaagggtgatcga ctcagcgctgagatcaatctgcctgactatcttgactttgccgagtctgggcaagtctac tttggaatcattgccctgtga

DBGET integrated database retrieval system