Panthera tigris altaica (Amur tiger): 102962805 Help Entry 102962805         CDS       T02988                                  Symbol CXCL12 Name (RefSeq) C-X-C motif chemokine ligand 12   KO K10031   C-X-C motif chemokine 12 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04060   Cytokine-cytokine receptor interaction ptg04061   Viral protein interaction with cytokine and cytokine receptor ptg04062   Chemokine signaling pathway ptg04064   NF-kappa B signaling pathway ptg04360   Axon guidance ptg04670   Leukocyte transendothelial migration ptg04672   Intestinal immune network for IgA production ptg04810   Regulation of actin cytoskeleton ptg05163   Human cytomegalovirus infection ptg05200   Pathways in cancer ptg05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102962805 (CXCL12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102962805 (CXCL12)    04061 Viral protein interaction with cytokine and cytokine receptor     102962805 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102962805 (CXCL12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102962805 (CXCL12)    04672 Intestinal immune network for IgA production     102962805 (CXCL12)    04062 Chemokine signaling pathway     102962805 (CXCL12)   09158 Development and regeneration    04360 Axon guidance     102962805 (CXCL12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102962805 (CXCL12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102962805 (CXCL12)   09163 Immune disease    05323 Rheumatoid arthritis     102962805 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102962805 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:ptg00536]     102962805 (CXCL12) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Chemokines    102962805 (CXCL12) Glycosaminoglycan binding proteins [BR:ptg00536]  Heparan sulfate / Heparin   Chemokines    102962805 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102962805 NCBI-ProteinID:  XP_015392085 LinkDB All DBs Position Un AA seq 76 aa AA seqDB search PLLGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLK WIQEYLEKALNKRFKM NT seq 231 nt NT seq  +upstreamnt  +downstreamnt cctcttctagggaaaccggtcagcctgagctacagatgtccttgccgattcttcgagagc cacgttgccagagccaacgtcaagcatctcaaaatcctcaacactccgaactgtgccctt cagatcgtggcgaggctgaagaacaacaatagacaagtgtgcattgacccgaaattgaag tggattcaggaatacctggagaaagctttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system