Panthera tigris altaica (Amur tiger): 102963756 Help Entry 102963756         CDS       T02988                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg03050   Proteasome ptg04060   Cytokine-cytokine receptor interaction ptg04066   HIF-1 signaling pathway ptg04217   Necroptosis ptg04350   TGF-beta signaling pathway ptg04380   Osteoclast differentiation ptg04612   Antigen processing and presentation ptg04630   JAK-STAT signaling pathway ptg04650   Natural killer cell mediated cytotoxicity ptg04657   IL-17 signaling pathway ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04660   T cell receptor signaling pathway ptg04940   Type I diabetes mellitus ptg05140   Leishmaniasis ptg05142   Chagas disease ptg05143   African trypanosomiasis ptg05144   Malaria ptg05145   Toxoplasmosis ptg05146   Amoebiasis ptg05152   Tuberculosis ptg05160   Hepatitis C ptg05164   Influenza A ptg05168   Herpes simplex virus 1 infection ptg05200   Pathways in cancer ptg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptg05321   Inflammatory bowel disease ptg05322   Systemic lupus erythematosus ptg05323   Rheumatoid arthritis ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     102963756 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     102963756 (IFNG)    04630 JAK-STAT signaling pathway     102963756 (IFNG)    04066 HIF-1 signaling pathway     102963756 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102963756 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102963756 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102963756 (IFNG)    04612 Antigen processing and presentation     102963756 (IFNG)    04660 T cell receptor signaling pathway     102963756 (IFNG)    04658 Th1 and Th2 cell differentiation     102963756 (IFNG)    04659 Th17 cell differentiation     102963756 (IFNG)    04657 IL-17 signaling pathway     102963756 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     102963756 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102963756 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102963756 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     102963756 (IFNG)    05164 Influenza A     102963756 (IFNG)    05168 Herpes simplex virus 1 infection     102963756 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     102963756 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     102963756 (IFNG)    05144 Malaria     102963756 (IFNG)    05145 Toxoplasmosis     102963756 (IFNG)    05140 Leishmaniasis     102963756 (IFNG)    05142 Chagas disease     102963756 (IFNG)    05143 African trypanosomiasis     102963756 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     102963756 (IFNG)    05323 Rheumatoid arthritis     102963756 (IFNG)    05321 Inflammatory bowel disease     102963756 (IFNG)    05330 Allograft rejection     102963756 (IFNG)    05332 Graft-versus-host disease     102963756 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102963756 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102963756 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:ptg03051]     102963756 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102963756 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:ptg00536]     102963756 (IFNG) Proteasome [BR:ptg03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     102963756 (IFNG) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Interferons    102963756 (IFNG) Glycosaminoglycan binding proteins [BR:ptg00536]  Heparan sulfate / Heparin   Cytokines    102963756 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma COG6_C MSP1_C Motif Other DBs NCBI-GeneID:  102963756 NCBI-ProteinID:  XP_007082284 UniProt:  A0A5B9GFL5 LinkDB All DBs Position Un AA seq 167 aa AA seqDB search MNYTSFIFAFQLCIILCSSGCYCQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWK EESDKTIIQSQIVSFYLKMFENLKDDDQRIQRNMDTIKEDMLDKLLNTSSSKRDDFLKLI QIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgaattacacaagttttattttcgcttttcagctttgcataattttgtgttcttctggt tgttactgtcaggccatgttttttaaagaaatagaagagctaaagggatattttaatgca agtaatccagatgtagcagatggtgggtcgcttttcgtagacattttgaagaactggaaa gaggagagtgataaaacaataattcaaagccaaattgtctccttctacttgaaaatgttt gaaaacctgaaagatgatgaccagcgcattcaaaggaacatggacaccatcaaggaagac atgcttgataagttgttaaataccagctccagtaaacgggatgacttcctcaagctgatt caaatccctgtgaatgatctgcaggtccagcgcaaagcaataaatgaactcttcaaagtg atgaatgatctgtcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgttt cgaggccgtagagcatcgaaataa

DBGET integrated database retrieval system