Panthera tigris altaica (Amur tiger): 102964789 Help Entry 102964789         CDS       T02988                                  Symbol MYL9 Name (RefSeq) myosin light chain 9   KO K12755   myosin regulatory light chain 9 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04022   cGMP-PKG signaling pathway ptg04024   cAMP signaling pathway ptg04270   Vascular smooth muscle contraction ptg04360   Axon guidance ptg04510   Focal adhesion ptg04520   Adherens junction ptg04530   Tight junction ptg04670   Leukocyte transendothelial migration ptg04810   Regulation of actin cytoskeleton ptg04814   Motor proteins ptg04820   Cytoskeleton in muscle cells ptg04921   Oxytocin signaling pathway ptg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102964789 (MYL9)    04022 cGMP-PKG signaling pathway     102964789 (MYL9)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102964789 (MYL9)    04520 Adherens junction     102964789 (MYL9)    04530 Tight junction     102964789 (MYL9)   09142 Cell motility    04814 Motor proteins     102964789 (MYL9)    04820 Cytoskeleton in muscle cells     102964789 (MYL9)    04810 Regulation of actin cytoskeleton     102964789 (MYL9)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102964789 (MYL9)   09152 Endocrine system    04921 Oxytocin signaling pathway     102964789 (MYL9)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102964789 (MYL9)   09158 Development and regeneration    04360 Axon guidance     102964789 (MYL9)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102964789 (MYL9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ptg04812]     102964789 (MYL9)    04147 Exosome [BR:ptg04147]     102964789 (MYL9) Cytoskeleton proteins [BR:ptg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      102964789 (MYL9) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of hepatic cells    102964789 (MYL9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_5 EF-hand_11 EF-hand_9 EF_EFCAB10_C GPHH SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  102964789 NCBI-ProteinID:  XP_007077746 UniProt:  A0A8C9JVD0 LinkDB All DBs Position Un AA seq 172 aa AA seqDB search MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaagcgagccaaggccaaaaccaccaagaagcggccacagcgggccacatct aatgtctttgcgatgtttgaccagtcccagatccaggagtttaaggaggccttcaatatg attgaccagaaccgagatggcttcattgacaaggaggacttgcatgacatgctggcctcg ctggggaagaaccccacagatgagtaccttgagggcatgatgagcgaggccccggggccc atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacagatcctgag gatgtgatccgaaatgccttcgcctgcttcgacgaggaggcctcaggttttattcacgag gaccacctacgggagctgctcaccaccatgggcgaccgcttcacagatgaagaagtggat gagatgtaccgagaggcacccattgataagaaaggcaacttcaactatgtggagttcacc cgcatcctcaagcatggggccaaggacaaggatgactag

DBGET integrated database retrieval system