Panthera tigris altaica (Amur tiger): 102969772 Help Entry 102969772         CDS       T02988                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01521   EGFR tyrosine kinase inhibitor resistance ptg04010   MAPK signaling pathway ptg04014   Ras signaling pathway ptg04015   Rap1 signaling pathway ptg04020   Calcium signaling pathway ptg04151   PI3K-Akt signaling pathway ptg04550   Signaling pathways regulating pluripotency of stem cells ptg04810   Regulation of actin cytoskeleton ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05200   Pathways in cancer ptg05205   Proteoglycans in cancer ptg05207   Chemical carcinogenesis - receptor activation ptg05218   Melanoma ptg05224   Breast cancer ptg05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102969772 (FGF2)    04014 Ras signaling pathway     102969772 (FGF2)    04015 Rap1 signaling pathway     102969772 (FGF2)    04020 Calcium signaling pathway     102969772 (FGF2)    04151 PI3K-Akt signaling pathway     102969772 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102969772 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102969772 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102969772 (FGF2)    05205 Proteoglycans in cancer     102969772 (FGF2)    05207 Chemical carcinogenesis - receptor activation     102969772 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     102969772 (FGF2)    05218 Melanoma     102969772 (FGF2)    05224 Breast cancer     102969772 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     102969772 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102969772 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102969772 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:ptg00536]     102969772 (FGF2) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Growth factors (RTK binding)    102969772 (FGF2) Glycosaminoglycan binding proteins [BR:ptg00536]  Heparan sulfate / Heparin   Growth factors/receptors    102969772 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF IL1 Fascin Motif Other DBs NCBI-GeneID:  102969772 NCBI-ProteinID:  XP_007087689 LinkDB All DBs Position Un AA seq 123 aa AA seqDB search YCKNGGFFLPIPPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLL ASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMS AKS NT seq 372 nt NT seq  +upstreamnt  +downstreamnt tactgcaaaaacgggggcttcttcctgcccatcccccccgacggccgagtggatggggtc cgggagaagagcgaccctcacatcaaactgcaacttcaggcagaagagagaggggttgtg tccatcaaaggagtctgtgcaaaccgctatcttgccatgaaggaagatggaagattactg gcttctaaatgtgttacggacgagtgtttcttttttgaacgattggaatctaataactac aatacttatcggtcaaggaaatactccagctggtatgtggcactgaaacgaactgggcag tataaacttggacccaaaacaggacctgggcagaaagctatactttttcttccaatgtct gctaagagctga

DBGET integrated database retrieval system