Panthera tigris altaica (Amur tiger): 107181018 Help Entry 107181018         CDS       T02988                                  Symbol GNA11 Name (RefSeq) G protein subunit alpha 11   KO K04635   guanine nucleotide-binding protein subunit alpha-11 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04020   Calcium signaling pathway ptg04022   cGMP-PKG signaling pathway ptg04081   Hormone signaling ptg04082   Neuroactive ligand signaling ptg04270   Vascular smooth muscle contraction ptg04540   Gap junction ptg04725   Cholinergic synapse ptg04730   Long-term depression ptg04911   Insulin secretion ptg04912   GnRH signaling pathway ptg04925   Aldosterone synthesis and secretion ptg04927   Cortisol synthesis and secretion ptg04928   Parathyroid hormone synthesis, secretion and action ptg04929   GnRH secretion ptg04934   Cushing syndrome ptg04935   Growth hormone synthesis, secretion and action ptg05142   Chagas disease ptg05146   Amoebiasis ptg05163   Human cytomegalovirus infection ptg05170   Human immunodeficiency virus 1 infection ptg05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04020 Calcium signaling pathway     107181018 (GNA11)    04022 cGMP-PKG signaling pathway     107181018 (GNA11)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     107181018 (GNA11)    04081 Hormone signaling     107181018 (GNA11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     107181018 (GNA11)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     107181018 (GNA11)    04929 GnRH secretion     107181018 (GNA11)    04912 GnRH signaling pathway     107181018 (GNA11)    04935 Growth hormone synthesis, secretion and action     107181018 (GNA11)    04928 Parathyroid hormone synthesis, secretion and action     107181018 (GNA11)    04925 Aldosterone synthesis and secretion     107181018 (GNA11)    04927 Cortisol synthesis and secretion     107181018 (GNA11)   09153 Circulatory system    04270 Vascular smooth muscle contraction     107181018 (GNA11)   09156 Nervous system    04725 Cholinergic synapse     107181018 (GNA11)    04730 Long-term depression     107181018 (GNA11)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107181018 (GNA11)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107181018 (GNA11)    05163 Human cytomegalovirus infection     107181018 (GNA11)   09174 Infectious disease: parasitic    05146 Amoebiasis     107181018 (GNA11)    05142 Chagas disease     107181018 (GNA11)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     107181018 (GNA11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     107181018 (GNA11)    04031 GTP-binding proteins [BR:ptg04031]     107181018 (GNA11) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    107181018 (GNA11)   Exosomal proteins of melanoma cells    107181018 (GNA11) GTP-binding proteins [BR:ptg04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 3 (Gq/11) [OT]     107181018 (GNA11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Motif Other DBs NCBI-GeneID:  107181018 NCBI-ProteinID:  XP_015399480 LinkDB All DBs Position Un AA seq 251 aa AA seqDB search MGCPWRFLPLLLLLLVSVLLVLLLSACWSCWAGDLLAETVGSLSRPLVMPRLLLGERLSP SSCGDGDPSPCVTDICAPYADEGMGLQGLPPGSPDLGLLRGQVPGRGAPGQGSVSRRSIM FLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILHSH LVDYFPEFDGEPASSAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTI LQLNLKEYNLV NT seq 756 nt NT seq  +upstreamnt  +downstreamnt atggggtgtccctggcgtttcctccccctgctgctccttctgctggtgagcgtgttgtta gtactgttactttccgcgtgttggtcctgctgggcaggagacctgctggcagagacagtt ggctctctgagccgcccccttgtgatgccgaggctcctcttgggcgagcgtttatctccg tcctcttgtggagatggagacccttccccgtgtgtcacagacatctgtgcaccctacgca gacgagggcatgggtctccaggggttgcccccgggctccccagacctgggactccttcgg gggcaggtgcccggacgcggtgcccccggccagggcagcgtgtcccgcaggtccatcatg ttcctcgtggccctgagtgagtacgaccaagtgctggtggagtcggacaacgagaaccgc atggaggagagcaaagccctgttccggaccatcatcacctacccctggttccagaactcc tcggtcatcctgttcctcaacaagaaggacctgctggaggacaagatcctgcactcccac ctggtggactacttcccggagttcgacggtgagccggcctcctccgccgcccgggagttc atcctgaagatgttcgtggacctgaaccccgacagcgacaagatcatctactcccatttc acatgcgccaccgacacggagaacatccgcttcgtgttcgcggccgtcaaggacaccatc ctgcagctcaacctgaaggagtacaacctcgtgtga

DBGET integrated database retrieval system