Pelotomaculum thermopropionicum: PTH_0240 Help Entry PTH_0240          CDS       T00519                                  Name (GenBank) ferredoxin   KO K00395   adenylylsulfate reductase, subunit B [EC:1.8.99.2] Organism pth  Pelotomaculum thermopropionicum Pathway pth00920   Sulfur metabolism pth01100   Metabolic pathways pth01120   Microbial metabolism in diverse environments pth01320   Sulfur cycle Brite KEGG Orthology (KO) [BR:pth00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     PTH_0240 Enzymes [BR:pth01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.99  With unknown physiological acceptors     1.8.99.2  adenylyl-sulfate reductase      PTH_0240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_9 Fer4_6 Fer4_10 Fer4_16 Fer4_4 Fer4_21 Fer4_3 Fer4_2 Fer4_11 Fer4_17 Fer4_8 Motif Other DBs NCBI-ProteinID:  BAF58421 UniProt:  A5D5R6 LinkDB All DBs Position 242427..242759 Genome browser AA seq 110 aa AA seqDB search MAVRVNRSLCNGCGDMAEPMCVAVCPGDLLYRDESNRCAVRDWRDCWDCAACVKECPRQA IEMFLPVQIGGRGSTLTARSGRGRITWKLTRPDGKEEIFEIINQTFNEVK NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggctgtaagggtaaacaggtccttgtgcaacggctgcggtgatatggcggagcccatg tgtgtcgccgtctgccctggagatcttttgtacagggacgagtcaaacaggtgtgcggtc agggactggagggactgctgggactgcgctgcctgtgttaaggaatgccccaggcaggcg attgaaatgttcctgcccgtgcagataggcggcaggggctcgaccttgacagcaaggtcc ggcaggggccggattacctggaagctgaccaggccggacggaaaggaagaaatatttgag ataatcaaccagacgtttaacgaggtgaagtga

DBGET integrated database retrieval system