KEGG   Phaeodactylum tricornutum: PHATRDRAFT_12877
Entry
PHATRDRAFT_12877  CDS       T01075                                 
Name
(RefSeq) hypothetical protein
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pti00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PHATRDRAFT_12877
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pti04121]
    PHATRDRAFT_12877
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     PHATRDRAFT_12877
Ubiquitin system [BR:pti04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    PHATRDRAFT_12877
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-C3HC4_2 zf-C3HC4_3 zf-met Zf_1st_IFT121 zf-C2H2_4
Other DBs
NCBI-GeneID: 7201293
NCBI-ProteinID: XP_002180483
JGI: 12877
UniProt: B7G0I6
LinkDB
Position
9:671223..672121
AA seq 234 aa
CVHYERNCNMVAPCCNSVFGCRICHDELSPTGHPPMNRFLVQEVVCKNCSTRQRASNQCT
NCQTVFGEYHCGICNLWMSKKPFHCVQCGFCRVGGVEAFRHCNECCMCISVTVFDNHQCF
KDKYKNNCPVCHEDMFSSRQSPQDLPCGHAIHAHCFRKLAGFDYRCPICKKTVVSQQSMA
AAWEARARDIAEHPMPADLQRIVDIMCNDCEAKSHRQQWHFLGIQCPRCSSFNT
NT seq 702 nt   +upstreamnt  +downstreamnt
tgcgtacactacgaacgcaactgcaacatggtagcaccttgctgtaatagcgtctttggg
tgccgcatctgtcacgatgagctcagtccaacgggacatccgcccatgaaccgatttctc
gtgcaagaagttgtctgcaaaaattgtagtactcgtcagcgcgcctccaatcaatgcacc
aattgtcagacagtttttggagaataccattgtggaatttgtaacctgtggatgtcaaag
aaaccctttcattgtgtccagtgtggattttgccgcgtcggtggtgtagaggcgttccgc
cactgcaacgaatgctgcatgtgcatttccgtcacagtctttgacaaccaccagtgcttc
aaggacaagtataagaacaattgccccgtctgccacgaagacatgtttagttcgcggcag
tccccccaagacttaccttgcggtcacgctattcacgcccactgttttcggaaactggcc
ggctttgattaccggtgtccaatttgtaaaaagacggtcgtatcgcagcaaagcatggcg
gcggcatgggaagcgcgcgcacgggatattgccgagcatccaatgccggcggatttgcaa
cgtatcgtggatattatgtgcaatgattgcgaagcgaaatcacatcgtcagcagtggcac
tttctgggtattcagtgtccgcgctgctcctcgttcaatacg

DBGET integrated database retrieval system