Paramecium tetraurelia: GSPATT00030724001 Help Entry GSPATT00030724001 CDS       T01055                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ptm  Paramecium tetraurelia Pathway ptm03420   Nucleotide excision repair ptm04120   Ubiquitin mediated proteolysis ptm04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ptm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     GSPATT00030724001    04120 Ubiquitin mediated proteolysis     GSPATT00030724001   09124 Replication and repair    03420 Nucleotide excision repair     GSPATT00030724001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ptm04121]     GSPATT00030724001    03400 DNA repair and recombination proteins [BR:ptm03400]     GSPATT00030724001 Enzymes [BR:ptm01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      GSPATT00030724001 Ubiquitin system [BR:ptm04121]  Ubiquitin ligases (E3)   UBL E3 ligases    GSPATT00030724001   Multi subunit type E3    SCF complex     Ring finger protein      GSPATT00030724001    Cul2 complex      GSPATT00030724001    Cul3 complex      GSPATT00030724001    Cul4 complex      GSPATT00030724001    Cul7 complex      GSPATT00030724001    Cul8 complex      GSPATT00030724001    Cul9 complex      GSPATT00030724001 DNA repair and recombination proteins [BR:ptm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       GSPATT00030724001     TCR (transcription coupled repair) factors      Cul4-CSA complex       GSPATT00030724001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 PHD_NSD zf-RING-like zf-C3HC4 zf-RING_16 Motif Other DBs NCBI-GeneID:  5013268 NCBI-ProteinID:  XP_001427484 Genoscope:  GSPATT00030724001 UniProt:  A0BNG9 LinkDB All DBs Position undetermined AA seq 108 aa AA seqDB search MQTESQYPQIDVKEFKAFAVWRWKAEQLNQNCCSCKKLMTEPCIDCEVNDQNDEQEKCIA VQSGNCGHALHQHCIRKWIQTKSQGGTSGTCPMCDLIWEITNEVELQN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgtaaaccgaatcacagtacccctaaatagatgtcaaggaattcaaggcatttgctgtt tggagatggaaagctgaacaattaaatcaaaattgttgttcatgcaaaaaattgatgact gaaccatgcattgattgcgaagtgaatgattagaatgatgagcaagaaaaatgcattgct gtttagagtggaaattgcggtcatgctttacatcagcattgcataagaaaatggattcaa accaaaagtcagggtggcacatcaggcacctgtccaatgtgtgacttgatttgggaaatc acaaatgaagtcgaattatagaattga

DBGET integrated database retrieval system