Pan troglodytes (chimpanzee): 100608101 Help Entry 100608101         CDS       T01005                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04810   Regulation of actin cytoskeleton ptr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptr00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100608101 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100608101 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 SPX LXG Matrilin_ccoil Motif Other DBs NCBI-GeneID:  100608101 NCBI-ProteinID:  XP_003950077 Ensembl:  ENSPTRG00000014612 VGNC:  9658 UniProt:  K7DHI6 A0A6D2WFQ5 LinkDB All DBs Position 3:10330459..10342069 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaggaggatccggtgcagcgggagattcaccaggactgggctaaccgggag tacattgagataatcaccagcagcatcaagaaaatcgcagactttctcaactcgttcgat atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagcccttgaacggaga atagagtacattgaagctcgggtgacaaaaggtgagacactcacctag

DBGET integrated database retrieval system