Pan troglodytes (chimpanzee): 100609360 Help Entry 100609360         CDS       T01005                                  Symbol MT1M Name (RefSeq) metallothionein-1M   KO K14739   metallothionein 1/2 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100609360 (MT1M)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ptr03019]     100609360 (MT1M)    03029 Mitochondrial biogenesis [BR:ptr03029]     100609360 (MT1M) Messenger RNA biogenesis [BR:ptr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100609360 (MT1M) Mitochondrial biogenesis [BR:ptr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100609360 (MT1M) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100609360 NCBI-ProteinID:  NP_001288206 Ensembl:  ENSPTRG00000044456 UniProt:  A0A2I3S770 A0A6D2XK04 LinkDB All DBs Position 18:54637912..54642307 Genome browser AA seq 61 aa AA seqDB search MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCFCCPVGCAKCAQGCVCKGMSENCCCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccactggtggctcctgcacgtgcgccggctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgcttctgctgccccgtgggc tgtgccaagtgtgcccagggctgtgtctgcaaagggatgtcagagaactgctgctgctgt gcctga

DBGET integrated database retrieval system