KEGG   Pan troglodytes (chimpanzee): 100609662
Entry
100609662         CDS       T01005                                 
Symbol
TP53AIP1
Name
(RefSeq) p53-regulated apoptosis-inducing protein 1
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04115  p53 signaling pathway
ptr04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100609662 (TP53AIP1)
   04115 p53 signaling pathway
    100609662 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 100609662
NCBI-ProteinID: XP_016777754
Ensembl: ENSPTRG00000042916
VGNC: 11710
UniProt: A0A2I3RA32 A0A6D2W9M0
LinkDB
Position
11:complement(124696864..124704160)
AA seq 86 aa
MGSSSEASFRSAQASCSGARRQGPGRGDQSLSVMPPNGRAQTHTPGWVSDLLVLGAQVHG
GCRGIEALSVSSGSWSSATVWILTVQ
NT seq 261 nt   +upstreamnt  +downstreamnt
atgggatcttcctctgaggcgagcttcagatctgctcaagcttcctgcagtggggccagg
aggcagggcccgggcaggggagaccagagcctctcggtgatgcctccgaatggcagggct
cagacacacacaccgggctgggtttcagatctcttagttttgggtgcccaagttcacgga
gggtgccggggaatagaagctctgtcagtctcatctggatcttggtcctcagcaactgtc
tggatcctgacagtgcagtaa

DBGET integrated database retrieval system