Pan troglodytes (chimpanzee): 100609808 Help Entry 100609808         CDS       T01005                                  Symbol MT1F Name (RefSeq) metallothionein-1F   KO K14739   metallothionein 1/2 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100609808 (MT1F)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ptr03019]     100609808 (MT1F)    03029 Mitochondrial biogenesis [BR:ptr03029]     100609808 (MT1F) Messenger RNA biogenesis [BR:ptr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100609808 (MT1F) Mitochondrial biogenesis [BR:ptr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100609808 (MT1F) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100609808 NCBI-ProteinID:  XP_003315160 Ensembl:  ENSPTRG00000031202 VGNC:  13737 UniProt:  A0A6D2WJF9 H2QB54 LinkDB All DBs Position 18:54658079..54659492 Genome browser AA seq 61 aa AA seqDB search MDPNCSCAAGGSCTCAGSCKCKECKCTSCKKSCCSCCPMGCSKCAQGCVCKGASEKCSCC D NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccgctggtggctcctgtacgtgcgccggctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccatgggc tgtagcaagtgtgcccagggctgtgtttgcaaaggggcgtcagagaagtgcagctgctgc gactga

DBGET integrated database retrieval system