Pan troglodytes (chimpanzee): 100610052 Help Entry 100610052         CDS       T01005                                  Symbol H2BC7 Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05203   Viral carcinogenesis ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100610052 (H2BC7)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100610052 (H2BC7)   09163 Immune disease    05322 Systemic lupus erythematosus     100610052 (H2BC7)   09165 Substance dependence    05034 Alcoholism     100610052 (H2BC7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     100610052 (H2BC7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     100610052 (H2BC7) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100610052 (H2BC7) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100610052 (H2BC7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100610052 NCBI-ProteinID:  XP_003311104 Ensembl:  ENSPTRG00000050249 VGNC:  83641 UniProt:  A0A6D2XZZ4 H2RDL9 LinkDB All DBs Position 5:32168134..32169986 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaacctgctaagtccgctcctgccccaaagaagggctccaaaaaggcggtgacc aaggcgcagaagaaggatggtaagaagcgcaagcgtagccgcaaggagagctattccgtg tacgtgtacaaggtgctaaagcaggtccaccccgacaccggcatctcatccaaggccatg ggcatcatgaactccttcgtcaacgatatcttcgagcgcatcgctggcgaggcttcccgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggctaagcacgccgtgtcagagggcaccaaggctgtcacc aagtacaccagctctaagtaa

DBGET integrated database retrieval system