Pan troglodytes (chimpanzee): 104007267 Help Entry 104007267         CDS       T01005                                  Name (RefSeq) metallothionein-1E   KO K14739   metallothionein 1/2 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     104007267  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ptr03019]     104007267    03029 Mitochondrial biogenesis [BR:ptr03029]     104007267 Messenger RNA biogenesis [BR:ptr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      104007267 Mitochondrial biogenesis [BR:ptr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     104007267 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  104007267 NCBI-ProteinID:  XP_054521514 LinkDB All DBs Position 1:198016847..198017254 Genome browser AA seq 61 aa AA seqDB search MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPMGCAKCAQGCICKGASEKCNCY A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccactggtggctcctgcacgtgcgccggctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccatgggc tgtgccaagtgtgcccagggctgcatctgcaaaggggcgtcggagaagtgcaactgctat gcctga

DBGET integrated database retrieval system