Pan troglodytes (chimpanzee): 107968666 Help Entry 107968666         CDS       T01005                                  Symbol ELOB Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04066   HIF-1 signaling pathway ptr04120   Ubiquitin mediated proteolysis ptr05170   Human immunodeficiency virus 1 infection ptr05200   Pathways in cancer ptr05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     107968666 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     107968666 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107968666 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     107968666 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107968666 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ptr04121]     107968666 (ELOB)    03400 DNA repair and recombination proteins [BR:ptr03400]     107968666 (ELOB) Ubiquitin system [BR:ptr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      107968666 (ELOB)    Cul5 complex      107968666 (ELOB) DNA repair and recombination proteins [BR:ptr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      107968666 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  107968666 NCBI-ProteinID:  XP_009428403 Ensembl:  ENSPTRG00000051587 LinkDB All DBs Position 18:complement(5386129..5392048) Genome browser AA seq 145 aa AA seqDB search MLGHARAAGNGAERGRAGASRGEAAAAMDVFLMIRRHKTTIFTDAKESSTVFELKRIVEG ILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPF SSPPELPDVMKPQDSGSSANEQAVQ NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgctgggccacgcgcgggctgccgggaacggggcggagcgcggccgcgccggcgcgtcg aggggagaggcagcagccgcgatggacgtgttcctcatgatccggcgccacaagaccacc atcttcacggacgccaaggagtccagcacggtgttcgaactgaagcgcatcgtcgagggc atcctcaagcggcctcctgacgagcagcggctgtacaaggatgaccaactcttggatgat ggcaagacactgggcgagtgtggcttcaccagtcaaacagcacggccacaggccccagcc acagtggggctggccttccgggcagatgacacctttgaggccctgtgcatcgagccgttt tccagcccgccagagctgcccgatgtgatgaagccccaggactcgggaagcagtgccaat gaacaagccgtgcagtga

DBGET integrated database retrieval system