Pan troglodytes (chimpanzee): 107970369 Help Entry 107970369         CDS       T01005                                  Symbol CRKL Name (RefSeq) crk-like protein   KO K04438   C-crk adapter molecule crk Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04010   MAPK signaling pathway ptr04012   ErbB signaling pathway ptr04015   Rap1 signaling pathway ptr04062   Chemokine signaling pathway ptr04148   Efferocytosis ptr04510   Focal adhesion ptr04666   Fc gamma R-mediated phagocytosis ptr04722   Neurotrophin signaling pathway ptr04810   Regulation of actin cytoskeleton ptr04910   Insulin signaling pathway ptr04935   Growth hormone synthesis, secretion and action ptr05100   Bacterial invasion of epithelial cells ptr05135   Yersinia infection ptr05163   Human cytomegalovirus infection ptr05170   Human immunodeficiency virus 1 infection ptr05200   Pathways in cancer ptr05206   MicroRNAs in cancer ptr05211   Renal cell carcinoma ptr05220   Chronic myeloid leukemia Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107970369 (CRKL)    04012 ErbB signaling pathway     107970369 (CRKL)    04015 Rap1 signaling pathway     107970369 (CRKL)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     107970369 (CRKL)   09144 Cellular community - eukaryotes    04510 Focal adhesion     107970369 (CRKL)   09142 Cell motility    04810 Regulation of actin cytoskeleton     107970369 (CRKL)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     107970369 (CRKL)    04062 Chemokine signaling pathway     107970369 (CRKL)   09152 Endocrine system    04910 Insulin signaling pathway     107970369 (CRKL)    04935 Growth hormone synthesis, secretion and action     107970369 (CRKL)   09156 Nervous system    04722 Neurotrophin signaling pathway     107970369 (CRKL)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107970369 (CRKL)    05206 MicroRNAs in cancer     107970369 (CRKL)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     107970369 (CRKL)    05211 Renal cell carcinoma     107970369 (CRKL)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107970369 (CRKL)    05163 Human cytomegalovirus infection     107970369 (CRKL)   09171 Infectious disease: bacterial    05135 Yersinia infection     107970369 (CRKL)    05100 Bacterial invasion of epithelial cells     107970369 (CRKL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SH3_2 SH2 SH3_1 SH3_9 hSH3 Motif Other DBs NCBI-GeneID:  107970369 NCBI-ProteinID:  XP_016795233 Ensembl:  ENSPTRG00000014094 ENSPTRG00000047066 VGNC:  12833 UniProt:  H2R472 A0A6D2Y4N2 LinkDB All DBs Position 22:complement(299092..335440) Genome browser AA seq 303 aa AA seqDB search MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD ENE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atgtcctccgccaggttcgactcctcggaccgctccgcctggtacatggggccggtgtct cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctcgtccgcgat tcttccacctgccctggggactatgtgctgtcggtgtccgagaactcgcgggtctcccac tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggaatttgaccat ttgccggccctgctggagttttacaagatccactacctggacaccaccacccttatcgag cctgcgcccaggtatccaagcccaccaatgggatctgtctcagcacccaacctgcctaca gcagaagataacctggaatatgtacggactctgtatgattttcctgggaatgatgccgaa gacctgccctttaaaaagggtgagatcctagtgataatagagaagcctgaagaacagtgg tggagtgcccggaacaaggatggccgggttgggatgattcctgtcccttatgtcgaaaag cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc ccagaacctgctcatgcatacgctcaacctcagaccacaactcctctacctgcagtttcc ggttctcctggggcagcaatcacccctttgccatccacacagaatggacctgtctttgcg aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt ggtgacatcgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaggtgaac gggcgcaaagggcttttcccctttacgcacgtcaaaatctttgaccctcaaaacccagat gaaaacgagtga

DBGET integrated database retrieval system