Pan troglodytes (chimpanzee): 107971249 Help Entry 107971249         CDS       T01005                                  Symbol H2AB1 Name (RefSeq) histone H2A-Bbd type 2/3   KO K11251   histone H2A Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03082   ATP-dependent chromatin remodeling ptr04217   Necroptosis ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     107971249 (H2AB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     107971249 (H2AB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107971249 (H2AB1)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     107971249 (H2AB1)   09165 Substance dependence    05034 Alcoholism     107971249 (H2AB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     107971249 (H2AB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     107971249 (H2AB1) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107971249 (H2AB1) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107971249 (H2AB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone BetR CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  107971249 NCBI-ProteinID:  XP_003317840 Ensembl:  ENSPTRG00000046462 ENSPTRG00000052848 VGNC:  83689 UniProt:  H2RHT0 A0A6D2W8Z0 LinkDB All DBs Position X:152281281..152281917 Genome browser AA seq 115 aa AA seqDB search MPRRRRHRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGQYAQRLSRTAPVYLAAVI EYLTAKVLELAGNEAQNSGARNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgccgaggaggaggagacaccgagggtcctccggtgctggcggccgggggcggacctgc tctcgcaccgtccgagcggagctttcgttttcagtgagccaggtggagcgcagtctacgg gagggccagtacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttatt gagtacctgacggccaaggtcctggagctggcgggcaacgaggcccagaacagcggagcg cggaacatcactcccctgctgctggacatggtggttcacaacgacaggctactgagcacc cttttcaacacgaccaccatctctcaagtggcccccggcgaggactag

DBGET integrated database retrieval system