Pan troglodytes (chimpanzee): 112204199 Help Entry 112204199         CDS       T01005                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr00190   Oxidative phosphorylation ptr01100   Metabolic pathways ptr01524   Platinum drug resistance ptr04115   p53 signaling pathway ptr04210   Apoptosis ptr04215   Apoptosis - multiple species ptr04932   Non-alcoholic fatty liver disease ptr05010   Alzheimer disease ptr05012   Parkinson disease ptr05014   Amyotrophic lateral sclerosis ptr05016   Huntington disease ptr05017   Spinocerebellar ataxia ptr05020   Prion disease ptr05022   Pathways of neurodegeneration - multiple diseases ptr05132   Salmonella infection ptr05134   Legionellosis ptr05145   Toxoplasmosis ptr05152   Tuberculosis ptr05160   Hepatitis C ptr05161   Hepatitis B ptr05162   Measles ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05168   Herpes simplex virus 1 infection ptr05169   Epstein-Barr virus infection ptr05170   Human immunodeficiency virus 1 infection ptr05200   Pathways in cancer ptr05210   Colorectal cancer ptr05222   Small cell lung cancer ptr05416   Viral myocarditis ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     112204199  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     112204199  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112204199   09162 Cancer: specific types    05210 Colorectal cancer     112204199    05222 Small cell lung cancer     112204199   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112204199    05161 Hepatitis B     112204199    05160 Hepatitis C     112204199    05164 Influenza A     112204199    05162 Measles     112204199    05163 Human cytomegalovirus infection     112204199    05167 Kaposi sarcoma-associated herpesvirus infection     112204199    05169 Epstein-Barr virus infection     112204199   09171 Infectious disease: bacterial    05134 Legionellosis     112204199    05152 Tuberculosis     112204199   09174 Infectious disease: parasitic    05145 Toxoplasmosis     112204199   09164 Neurodegenerative disease    05010 Alzheimer disease     112204199    05012 Parkinson disease     112204199    05014 Amyotrophic lateral sclerosis     112204199    05016 Huntington disease     112204199    05017 Spinocerebellar ataxia     112204199    05020 Prion disease     112204199    05022 Pathways of neurodegeneration - multiple diseases     112204199   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112204199    05416 Viral myocarditis     112204199   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     112204199   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     112204199 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Imm43 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  112204199 NCBI-ProteinID:  XP_063673431 LinkDB All DBs Position 7:complement(129935089..129935575) Genome browser AA seq 104 aa AA seqDB search MGDVEKGKRIFVQKCAQFHTVEKGGKQVAGSNLHGLFVGKTDQTIGFSYTEAHKNKSISW GEDTLMEYLENPKKHIPGTKMIFADMKNKAERAALIAHLKKSYQ NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgaaaaaggcaagagaatttttgttcagaagtgtgcccagttccacact gttgaaaagggaggcaaacaggtggctgggtcaaatctccatggtctctttgtggggaag acagatcagaccattggattctcttatacagaggcccataagaacaaaagcatctcctgg ggagaggatacactcatggagtatttggagaatcccaagaagcacatccccggaacaaaa atgatctttgcagacatgaagaacaaggcagaaagggcagccttgatagctcatctcaaa aaaagctaccaatga

DBGET integrated database retrieval system