Pan troglodytes (chimpanzee): 115945179 Help Entry 115945179         CDS       T01005                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05203   Viral carcinogenesis ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     115945179  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     115945179   09163 Immune disease    05322 Systemic lupus erythematosus     115945179   09165 Substance dependence    05034 Alcoholism     115945179  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     115945179 Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115945179 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  115945179 NCBI-ProteinID:  NP_001361483 LinkDB All DBs Position 5:complement(33797810..33798178) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggcaaaggcgggaagggtcttggcaaaggcggcgctaagcgccatcgt aaagtattgcgcgacaatatccagggcatcaccaagccggctatccggcgccttgctcgc cgcggcggcgtgaagcgcatctccggcctcatctacgaggagactcgcggggtgctgaag gtgttcctggagaacgtgatccgggacgccgtgacctatacagagcacgccaagcgcaag acggtcaccgccatggatgtggtctacgcgctcaagcgccagggccgcaccctctacggt ttcggtggttga

DBGET integrated database retrieval system